Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.76
PubTator Score 5.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.900 2.1e-05
astrocytic glioma -1.900 4.1e-02
Astrocytoma, Pilocytic -1.700 3.5e-06
atypical teratoid / rhabdoid tumor -1.500 2.9e-05
Breast cancer -1.500 3.0e-58
cystic fibrosis 1.086 6.7e-05
Down syndrome 1.200 1.5e-03
ependymoma -3.000 2.0e-02
glioblastoma -1.700 1.7e-05
group 3 medulloblastoma -1.300 1.0e-02
interstitial cystitis -2.400 2.5e-02
medulloblastoma, large-cell -1.800 1.1e-05
oligodendroglioma -2.000 3.8e-02
ovarian cancer -2.000 2.5e-03
Pick disease -1.100 2.0e-02
pituitary cancer 1.200 2.3e-02
primitive neuroectodermal tumor -1.300 3.8e-04
progressive supranuclear palsy -1.800 1.0e-02
subependymal giant cell astrocytoma -1.396 5.0e-02

Gene RIF (4)

AA Sequence

MLKVSAVLCVCAAAWCSQSLAAAAAVAAAGGRSDGGNFLDDKQWLTTISQYDKEVGQWNKFRDEVEDDYF      1 - 70
RTWSPGKPFDQALDPAKDPCLKMKCSRHKVCIAQDSQTAVCISHRRLTHRMKEAGVDHRQWRGPILSTCK     71 - 140
QCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEGHCPCPSDKPTSTSRNVKRACSDLEFREVA    141 - 210
NRLRDWFKALHESGSQNKKTKTLLRPERSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDK    211 - 280
NEQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDEDGYYKPT    281 - 350
QCHGSVGQCWCVDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMNDEDEIEDDDE    351 - 420
DEGDDDDGGDDHDVYI                                                          421 - 436
//

Text Mined References (14)

PMID Year Title