Property Summary

NCBI Gene PubMed Count 13
Grant Count 4
Funding $47,910.43
PubMed Score 5.48
PubTator Score 5.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
astrocytic glioma -3.000 0.030
ependymoma -4.900 0.000
oligodendroglioma -2.600 0.000
glioblastoma -4.400 0.000
sonic hedgehog group medulloblastoma -4.000 0.000
cystic fibrosis 1.086 0.000
atypical teratoid/rhabdoid tumor -4.100 0.000
medulloblastoma, large-cell -4.500 0.000
primitive neuroectodermal tumor -3.000 0.007
interstitial cystitis -2.800 0.002
pediatric high grade glioma -4.200 0.000
pilocytic astrocytoma -3.300 0.000
subependymal giant cell astrocytoma -4.523 0.002
Pick disease -1.600 0.019
progressive supranuclear palsy -1.800 0.010
Breast cancer -1.500 0.000
ovarian cancer -2.000 0.003
pituitary cancer 4.000 0.001
Down syndrome 1.300 0.004

Gene RIF (4)

PMID Text
25648963 associations, near SPOCK3 were identified and other putative modulators of memory performance were revealed by a
24292267 The results of this study suggest that SPOCK3 may modify the genetic risk for Attention-deficit/hyperactivity disorder and personality disorders
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19144404 High expression of testican 3 is associated with adult T-cell leukemia.

AA Sequence

MLKVSAVLCVCAAAWCSQSLAAAAAVAAAGGRSDGGNFLDDKQWLTTISQYDKEVGQWNKFRDEVEDDYF      1 - 70
RTWSPGKPFDQALDPAKDPCLKMKCSRHKVCIAQDSQTAVCISHRRLTHRMKEAGVDHRQWRGPILSTCK     71 - 140
QCPVVYPSPVCGSDGHTYSFQCKLEYQACVLGKQISVKCEGHCPCPSDKPTSTSRNVKRACSDLEFREVA    141 - 210
NRLRDWFKALHESGSQNKKTKTLLRPERSRFDTSILPICKDSLGWMFNRLDTNYDLLLDQSELRSIYLDK    211 - 280
NEQCTKAFFNSCDTYKDSLISNNEWCYCFQRQQDPPCQTELSNIQKRQGVKKLLGQYIPLCDEDGYYKPT    281 - 350
QCHGSVGQCWCVDRYGNEVMGSRINGVADCAIDFEISGDFASGDFHEWTDDEDDEDDIMNDEDEIEDDDE    351 - 420
DEGDDDDGGDDHDVYI                                                          421 - 436
//

Text Mined References (14)

PMID Year Title
25648963 2015 Genome-wide studies of verbal declarative memory in nondemented older people: the Cohorts for Heart and Aging Research in Genomic Epidemiology consortium.
24292267 2014 SPOCK3, a risk gene for adult ADHD and personality disorders.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19144404 2009 Testican 3 expression in adult T-cell leukemia.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...