Property Summary

NCBI Gene PubMed Count 15
PubMed Score 13.96
PubTator Score 20.32

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 4.6e-05
glioblastoma 1.200 3.5e-05
medulloblastoma, large-cell 1.300 9.6e-04

Synonym

Accession Q9BQ15 A6NDF8 Q6XYC8
Symbols SSB1
hSSB1
OBFC2B
SOSS-B1

Gene

PANTHER Protein Class (1)

PDB

4OWT   4OWW   4OWX   5D8E   5D8F  

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (8)

AA Sequence

MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRL      1 - 70
TKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGP     71 - 140
SAASPASENQNGNGLSAPPGPGGGPHPPHTPSHPPSTRITRSQPNHTPAGPPGPSSNPVSNGKETRRSSK    141 - 210
R//

Text Mined References (18)

PMID Year Title