Property Summary

NCBI Gene PubMed Count 14
Grant Count 5
R01 Count 5
Funding $526,693.99
PubMed Score 11.11
PubTator Score 20.32

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 1.300 0.001

Synonym

Accession Q9BQ15 A6NDF8 Q6XYC8
Symbols SSB1
hSSB1
OBFC2B
SOSS-B1

Gene

PANTHER Protein Class (1)

PDB

4OWT   4OWW   4OWX   5D8E  

Gene RIF (7)

PMID Text
26261212 In the absence of hSSB1, human 8-oxoguanine glycosylase 1 does not localize to chromatin, resulting in the accumulation of 8-oxoguanine in the genome.
24753408 The findings demonstrate the importance of hSSB1 in maintaining and repairing DNA replication forks and for overall genomic stability.
24104880 Identification of EEf1E1 and OBFC2B as novel BRCA1-partner genes in the DNA double-strand break repair pathway.
23178594 SOSS complexes, containing SSB1, do not localize with Replication Protein A (RPA) to replication sites in human cells, yet have a strong effect on double-strand break resection and homologous recombination.
19786574 INTS3 controls the SSB1-mediated DNA damage response.
19605351 hSSB1 and hSSB2 form two separate complexes with similar structures, and both complexes participate in DNA damage response.
18449195 Cells deficient in hSSB1 exhibit increased radiosensitivity, defective checkpoint activation and enhanced genomic instability coupled with a diminished capacity for DNA repair.

AA Sequence

MTTETFVKDIKPGLKNLNLIFIVLETGRVTKTKDGHEVRTCKVADKTGSINISVWDDVGNLIQPGDIIRL      1 - 70
TKGYASVFKGCLTLYTGRGGDLQKIGEFCMVYSEVPNFSEPNPEYSTQQAPNKAVQNDSNPSASQPTTGP     71 - 140
SAASPASENQNGNGLSAPPGPGGGPHPPHTPSHPPSTRITRSQPNHTPAGPPGPSSNPVSNGKETRRSSK    141 - 210
R//

Text Mined References (17)

PMID Year Title
26261212 2015 hSSB1 (NABP2/ OBFC2B) is required for the repair of 8-oxo-guanine by the hOGG1-mediated base excision repair pathway.
25589350 2015 Single-strand DNA-binding protein SSB1 facilitates TERT recruitment to telomeres and maintains telomere G-overhangs.
24753408 2014 Human single-stranded DNA binding protein 1 (hSSB1/NABP2) is required for the stability and repair of stalled replication forks.
24104880 2013 Identification of two novel BRCA1-partner genes in the DNA double-strand break repair pathway.
23178594 2013 The SOSS1 single-stranded DNA binding complex promotes DNA end resection in concert with Exo1.
21659603 2011 A DNA damage response screen identifies RHINO, a 9-1-1 and TopBP1 interacting protein required for ATR signaling.
21242961 2011 hSSB1 binds and protects p21 from ubiquitin-mediated degradation and positively correlates with p21 in human hepatocellular carcinomas.
19786574 2009 INTS3 controls the hSSB1-mediated DNA damage response.
19683501 2009 SOSS complexes participate in the maintenance of genomic stability.
19605351 2009 HSSB1 and hSSB2 form similar multiprotein complexes that participate in DNA damage response.
More...