Property Summary

NCBI Gene PubMed Count 3
PubMed Score 1.20

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BQ13 B2R9R8
Symbols

Gene

PANTHER Protein Class (1)

 Compartment GO Term (1)

AA Sequence

MWQGCAVERPVGRMTSQTPLPQSPRPRRPTMSTVVELNVGGEFHTTTLGTLRKFPGSKLAEMFSSLAKAS      1 - 70
TDAEGRFFIDRPSTYFRPILDYLRTGQVPTQHIPEVYREAQFYEIKPLVKLLEDMPQIFGEQVSRKQFLL     71 - 140
QVPGYSENLELMVRLARAEAITARKSSVLVCLVETEEQDAYYSEVLCFLQDKKMFKSVVKFGPWKAVLDN    141 - 210
SDLMHCLEMDIKAQGYKVFSKFYLTYPTKRNEFHFNIYSFTFTWW                             211 - 255
//

Text Mined References (6)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21269460 2011 Initial characterization of the human central proteome.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.