Property Summary

NCBI Gene PubMed Count 25
Grant Count 48
R01 Count 17
Funding $10,145,730.62
PubMed Score 91.54
PubTator Score 33.75

Knowledge Summary

Patent

No data available

Gene RIF (16)

PMID Text
25937206 The data demonstrated that RELM-a is a promising novel biomarker of angiogenesis in patients with gastric cancer.
25545115 elevated RELM-beta expression in asthmatic airways contributes to airways remodelling at least partly by increasing fibroblast proliferation and differentiation with resulting deposition of extracellular matrix proteins.
25479529 RELMbeta levels were increased in Abdominal aortic aneurysm patients in the serum and in the aortic tissue. Increased RELMbeta levels may be involved in the pathogenesis of AAA formation and progress.
23702657 RELMbeta is abundantly expressed in foam cells within plaques and contributes to atherosclerosis development via lipid accumulation and inflammatory facilitation.
23392702 It is concluded that proper exercise training prevents up-regulation of FIZZ1/RELMalpha induced by cigarette smoking, which may be involved in the mechanism of proper exercise training modulating airway hyperresponsiveness.
22758223 RELM-beta may play an important role not only in animal models of airway remodelling, but also in human airway pathology.
22726462 Epithelial cell derived Fizz1 transgene is sufficient to increase bone-marrow derived dendritic cells in the lungs.
22371635 Data show that over-expression of RELMbeta abolishes the invasion, metastasis and angiogenesis of gastric cancer cells in vitro.
21828035 RELM-beta has the potential to contribute to airway remodelling in diseases such as asthma by acting on epithelial cells to increase proliferation, mucin and growth factor production, at least partly via ERK/MAPK-PI3K/Akt signalling pathways.
21602491 FIZZ2 is highly induced in lungs of human patients with idiopathic pulmonary fibrosis.
More...

AA Sequence

MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAG      1 - 70
MAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT                                  71 - 111
//

Text Mined References (25)

PMID Year Title
25937206 2015 High expression of RELM-? correlates with poor prognosis and promotes angiogenesis in gastric cancer.
25545115 2015 Resistin-like molecule-? (RELM-?) targets airways fibroblasts to effect remodelling in asthma: from mouse to man.
25479529 2015 Association of resistin-like molecule ? levels and abdominal aortic aneurysm.
23702657 2013 Resistin-like molecule ? is abundantly expressed in foam cells and is involved in atherosclerosis development.
23392702 2013 Exercise training attenuated chronic cigarette smoking-induced up-regulation of FIZZ1/RELM? in lung of rats.
22758223 2012 Resistin-like molecule-? is induced following bronchoconstriction of asthmatic airways.
22726462 2012 Resistin-like molecule ?1 (Fizz1) recruits lung dendritic cells without causing pulmonary fibrosis.
22371635 2012 Effects of resistin-like molecule ? over-expression on gastric cancer cells in vitro.
21828035 2012 Resistin-like molecule-? is a human airway remodelling mediator.
21602491 2011 FIZZ2/RELM-? induction and role in pulmonary fibrosis.
More...