Property Summary

NCBI Gene PubMed Count 26
PubMed Score 98.59
PubTator Score 33.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Gene RIF (17)

AA Sequence

MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAG      1 - 70
MAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT                                  71 - 111
//

Text Mined References (26)

PMID Year Title