Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.43
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.500 8.3e-04
malignant mesothelioma 1.800 2.6e-07
primitive neuroectodermal tumor 1.400 4.7e-04
psoriasis -1.500 8.7e-05
tuberculosis and treatment for 6 months -1.100 1.4e-04

AA Sequence

MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKLHGVNINVEAS      1 - 70
KNKSKASTKLHVGNISPTCTNQELRAKFEEYGPVIECDIVKDYAFVHMERAEDAVEAIRGLDNTEFQGKR     71 - 140
MHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPVDRTGRVADFTEQYNEQYGAVRTPYTMGYGESMY    141 - 210
YNDAYGALDYYKRYRVRSYEAVAAAAAASAYNYAEQTMSHLPQVQSTTVTSHLNSTSVDPYDRHLLPNSG    211 - 280
AAATSAAMAAAAATTSSYYGRDRSPLRRAAAMLPTVGEGYGYGPESELSQASAATRNSLYDMARYEREQY    281 - 350
VDRARYSAF                                                                 351 - 359
//

Text Mined References (17)

PMID Year Title