Property Summary

NCBI Gene PubMed Count 41
PubMed Score 101.27
PubTator Score 570.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Breast cancer 3.300 2.5e-02
intraductal papillary-mucinous neoplasm ... 1.100 4.1e-02
osteosarcoma 2.133 1.3e-05
ovarian cancer -1.100 1.4e-04
pancreatic ductal adenocarcinoma liver m... -1.334 1.0e-02
Polycystic ovary syndrome -1.215 2.7e-03
tuberculosis 1.400 3.9e-07

Gene RIF (31)

AA Sequence

MAFLDNPTIILAHIRQSHVTSDDTGMCEMVLIDHDVDLEKIHPPSMPGDSGSEIQGSNGETQGYVYAQSV      1 - 70
DITSSWDFGIRRRSNTAQRLERLRKERQNQIKCKNIQWKERNSKQSAQELKSLFEKKSLKEKPPISGKQS     71 - 140
ILSVRLEQCPLQLNNPFNEYSKFDGKGHVGTTATKKIDVYLPLHSSQDRLLPMTVVTMASARVQDLIGLI    141 - 210
CWQYTSEGREPKLNDNVSAYCLHIAEDDGEVDTDFPPLDSNEPIHKFGFSTLALVEKYSSPGLTSKESLF    211 - 280
VRINAAHGFSLIQVDNTKVTMKEILLKAVKRRKGSQKVSGPQYRLEKQSEPNVAVDLDSTLESQSAWEFC    281 - 350
LVRENSSRADGVFEEDSQIDIATVQDMLSSHHYKSFKVSMIHRLRFTTDVQLGISGDKVEIDPVTNQKAS    351 - 420
TKFWIKQKPISIDSDLLCACDLAEEKSPSHAIFKLTYLSNHDYKHLYFESDAATVNEIVLKVNYILESRA    421 - 490
STARADYFAQKQRKLNRRTSFSFQKEKKSGQQ                                          491 - 522
//

Text Mined References (47)

PMID Year Title