Property Summary

NCBI Gene PubMed Count 19
PubMed Score 16.37
PubTator Score 16.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Colorectal Neoplasms 243 0.0 0.0
Disease Target Count Z-score Confidence
Advanced sleep phase syndrome 9 4.2 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
hereditary spastic paraplegia -1.179 6.0e-03
lung adenocarcinoma -1.500 2.1e-10
ovarian cancer -1.700 5.7e-06
pancreatic ductal adenocarcinoma liver m... -2.252 6.7e-03

Gene RIF (5)

AA Sequence

MKDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYMWMENEEEFNRQIEEELWEEEFIERCFQEMLEEEEE      1 - 70
HEWFIPARDLPQTMDQIQDQFNDLVISDGSSLEDLVVKSNLNPNAKEFVPGVKYGNI                  71 - 127
//

Text Mined References (20)

PMID Year Title