Property Summary

NCBI Gene PubMed Count 19
PubMed Score 15.87
PubTator Score 16.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 2.11791980937487E-10
ovarian cancer 8492 9.02302921327358E-5
hereditary spastic paraplegia 313 0.00603481721088625
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00669417777085636
Disease Target Count Z-score Confidence
Advanced sleep phase syndrome 10 4.258 2.1

Expression

  Differential Expression (4)

Disease log2 FC p
hereditary spastic paraplegia -1.179 0.006
pancreatic ductal adenocarcinoma liver m... -2.252 0.007
lung adenocarcinoma -1.500 0.000
ovarian cancer -1.900 0.000

Synonym

Gene

PDB

1JGN   3KUS   3KUT  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (5)

PMID Text
23964095 Paip2 is a host antiviral restriction factor antagonized by PABP accumulation in HCMV-infected cells
19240791 Observational study of gene-disease association. (HuGE Navigator)
16601676 The turnover of Paip2 in the cell is mediated by EDD and is regulated by PABP.
15175342 PAIP2 is a crucial regulator of VEGF mRNA and has a role in regulating angiogenesis
12820898 Role of PAIP2 in modulation of GLUT5 mRNA stability.

AA Sequence

MKDPSRSSTSPSIINEDVIINGHSHEDDNPFAEYMWMENEEEFNRQIEEELWEEEFIERCFQEMLEEEEE      1 - 70
HEWFIPARDLPQTMDQIQDQFNDLVISDGSSLEDLVVKSNLNPNAKEFVPGVKYGNI                  71 - 127
//

Text Mined References (20)

PMID Year Title
23964095 2013 A new role for the cellular PABP repressor Paip2 as an innate restriction factor capable of limiting productive cytomegalovirus replication.
19240791 2009 Integrated genomic analysis implicates haploinsufficiency of multiple chromosome 5q31.2 genes in de novo myelodysplastic syndromes pathogenesis.
16804161 2006 Regulation of poly(A) binding protein function in translation: Characterization of the Paip2 homolog, Paip2B.
16601676 2006 Poly(A) binding protein (PABP) homeostasis is mediated by the stability of its inhibitor, Paip2.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15175342 2004 Poly(A)-binding protein-interacting protein 2, a strong regulator of vascular endothelial growth factor mRNA.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14685257 2004 Structural basis of ligand recognition by PABC, a highly specific peptide-binding domain found in poly(A)-binding protein and a HECT ubiquitin ligase.
More...