Property Summary

NCBI Gene PubMed Count 8
PubMed Score 21.75
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BPZ2 Q7Z2M0
Symbols SPIN-2
TDRD26
SPIN-2B
dJ323P24.2
SPIN2_duplicate

Gene

  Ortholog (1)

Species Source Disease
Rat OMA EggNOG

Gene RIF (1)

AA Sequence

MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKG      1 - 70
TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE     71 - 140
HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI    141 - 210
GKHVEYTKEDGSKRIGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKKS                          211 - 258
//

Text Mined References (8)

PMID Year Title