Property Summary

NCBI Gene PubMed Count 7
PubMed Score 20.75
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
20351274 SERPINA3K is a high-affinity, endogenous antagonist of LRP6

AA Sequence

MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKG      1 - 70
TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE     71 - 140
HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI    141 - 210
GKHVEYTKEDGSKRIGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKKS                          211 - 258
//

Text Mined References (7)

PMID Year Title
20351274 2010 Blocking the Wnt pathway, a unifying mechanism for an angiogenic inhibitor in the serine proteinase inhibitor family.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12145692 2002 Functional cloning of SPIN-2, a nuclear anti-apoptotic protein with roles in cell cycle progression.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.