Property Summary

NCBI Gene PubMed Count 43
PubMed Score 506.50
PubTator Score 178.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
acute myeloid leukemia 1.100 1.4e-02
adrenocortical carcinoma -2.387 4.0e-03
astrocytic glioma -1.800 1.9e-02
Atopic dermatitis -1.800 1.0e-05
atypical teratoid / rhabdoid tumor -3.400 5.2e-07
Chronic Lymphocytic Leukemia -1.879 9.5e-06
cystic fibrosis -1.392 2.2e-05
ductal carcinoma in situ 2.100 4.7e-03
ependymoma -3.700 7.3e-03
esophageal adenocarcinoma -3.400 2.0e-02
facioscapulohumeral dystrophy 1.900 2.8e-02
glioblastoma -1.800 2.8e-03
group 3 medulloblastoma -2.700 1.2e-04
invasive ductal carcinoma 2.100 8.6e-04
lung adenocarcinoma -1.800 1.7e-04
lung cancer -5.600 2.1e-07
medulloblastoma, large-cell -4.900 6.6e-08
nasopharyngeal carcinoma -2.600 5.8e-07
nephrosclerosis 1.032 9.0e-03
non-small cell lung cancer -1.561 6.7e-12
oligodendroglioma -2.100 2.2e-02
ovarian cancer -1.100 6.2e-03
pancreatic cancer 1.600 3.5e-03
Pick disease -1.500 5.0e-03
primary pancreatic ductal adenocarcinoma 3.949 7.9e-05
primitive neuroectodermal tumor -2.400 6.8e-04
subependymal giant cell astrocytoma -3.183 1.0e-02
tuberculosis 1.900 2.1e-06
type I diabetes mellitus -1.000 1.0e-02
Waldenstrons macroglobulinemia -1.690 1.5e-03

Gene RIF (29)

AA Sequence

MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRS      1 - 70
VTD                                                                        71 - 73
//

Text Mined References (44)

PMID Year Title