Property Summary

NCBI Gene PubMed Count 37
PubMed Score 474.73
PubTator Score 178.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 6.67787236683969E-12
medulloblastoma 1524 1.50201740705562E-8
medulloblastoma, large-cell 6234 6.64962830229381E-8
atypical teratoid / rhabdoid tumor 4369 5.16327773377922E-7
nasopharyngeal carcinoma 1056 5.84176401531331E-7
tuberculosis 1563 2.05330247876101E-6
lung cancer 4473 2.65431687236732E-6
chronic lymphocytic leukemia 244 9.49175670131251E-6
Atopic dermatitis 944 1.04993314429659E-5
pancreatic cancer 2300 1.82785440490874E-5
cystic fibrosis 1670 2.23161235032531E-5
primary pancreatic ductal adenocarcinoma 1271 7.91086983458534E-5
lung adenocarcinoma 2714 1.73566563257347E-4
ovarian cancer 8492 2.88523574194851E-4
primitive neuroectodermal tumor 3031 6.78539473681904E-4
invasive ductal carcinoma 2950 8.57698697566331E-4
Waldenstrons macroglobulinemia 765 0.00150028578429346
glioblastoma 5572 0.00278855052353775
adrenocortical carcinoma 1427 0.00396803031196031
ductal carcinoma in situ 1745 0.00473281752708193
Pick disease 1893 0.00501573343496744
ependymoma 2514 0.0073307083870801
nephrosclerosis 329 0.00896960157425689
subependymal giant cell astrocytoma 2287 0.010008120817866
type I diabetes mellitus 22 0.0104325860423373
acute myeloid leukemia 785 0.0140991567651565
astrocytic glioma 2241 0.0190751141222838
esophageal adenocarcinoma 737 0.0203930186372884
oligodendroglioma 2849 0.0215147008993759
facioscapulohumeral dystrophy 286 0.028191562935656
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Expression

  Differential Expression (30)

Synonym

Accession Q9BPY8 A8K0Z2 E9PB55 G3V294 Q8N0V6 Q96CI1
Symbols HOD
HOP
OB1
LAGY
TOTO
CAMEO
NECC1
SMAP31

Gene

  Ortholog (10)

Gene RIF (25)

PMID Text
26286954 Data show that binding of heat shock proteins Hsp70 and Hsp90 requires prior binding of Hop protein to Hsp90.
25345926 HOPX is methylated and exerts tumour-suppressive function through Ras-induced senescence in human lung cancer.
25036325 The results suggest that HOPX may contribute to pathogenesis or manifestation of hypertrophic cardiomyopathy as a modifier gene.
23707782 GATA6 and HOPX are critical nodes in a lineage-selective pathway that directly links effectors of airway epithelial specification to the inhibition of metastasis in the lung ADC subtype.
23036489 Knockdown of Hop caused a decrease in the level of RhoC GTPase, and significantly inhibited pseudopodia formation in Hs578T cells. Our data suggest that Hop regulates directional cell migration by multiple unknown mechanisms.
22904674 HOPX-beta promoter methylation is a frequent and cancer-specific event in CRC progression.
21700222 results identify distinct functions for the Hop cochaperone, revealing an asymmetric mechanism for Hsp90 regulation and client loading
21382376 HOPX/Hopx expression is reduced in multiple examples of human and murine cardiac hypertrophy and failure.
21256618 HOP is a novel modulator of late terminal differentiation in keratinocytes
21061432 Hopx regulates the expression of genes involved in regulation of apoptosis and survival and makes them refractory to Fas-induced apoptosis.
More...

AA Sequence

MSAETASGPTEDQVEILEYNFNKVDKHPDSTTLCLIAAEAGLSEEETQKWFKQRLAKWRRSEGLPSECRS      1 - 70
VTD                                                                        71 - 73
//

Text Mined References (38)

PMID Year Title
26286954 2015 The joining of the Hsp90 and Hsp70 chaperone cycles yields transient interactions and stable intermediates: insights from mass spectrometry.
25416956 2014 A proteome-scale map of the human interactome network.
25345926 2015 HOPX is methylated and exerts tumour-suppressive function through Ras-induced senescence in human lung cancer.
25036325 2014 Association between non-coding polymorphisms of HOPX gene and syncope in hypertrophic cardiomyopathy.
23707782 2013 Control of alveolar differentiation by the lineage transcription factors GATA6 and HOPX inhibits lung adenocarcinoma metastasis.
23036489 2013 Knockdown of Hop downregulates RhoC expression, and decreases pseudopodia formation and migration in cancer cell lines.
22904674 2012 Epigenetic silencing of HOPX promotes cancer progression in colorectal cancer.
21700222 2011 Client-loading conformation of the Hsp90 molecular chaperone revealed in the cryo-EM structure of the human Hsp90:Hop complex.
21382376 2011 Homeodomain only protein x is down-regulated in human heart failure.
21256618 2011 Homeodomain-only protein HOP is a novel modulator of late differentiation in keratinocytes.
More...