Property Summary

NCBI Gene PubMed Count 32
Grant Count 26
R01 Count 20
Funding $3,433,473.03
PubMed Score 303.80
PubTator Score 93.35

Knowledge Summary

Patent

No data available

Expression

Gene RIF (18)

PMID Text
26489515 Our experiments provide novel details about how MCU/EMRE is regulated by MICU1 and an original approach to investigate MCU/EMRE activation in intact cells.
26336993 Data show that ribosomal protein S3 (RPS3) knockdown decreased mitochondrial calcium uptake 1 protein (MICU1) expression.
25824785 Loss of heterozygosity of MICU1 gene on chromosome 10q is associated with pancreatic cancer.
24560927 MICU1 and MICU2 have roles in tuning the mitochondrial Ca2+ uniporter by exerting opposite effects on MCU activity
24503055 Expression of MICU1 mutants lacking functional Ca2+-binding sites leads to a striking loss of Ca2+ uptake in HEK293 cells.
24336167 Loss-of-function mutations in MICU1 cause a brain and muscle disorder linked to primary alterations in mitochondrial calcium signaling.
24332854 MICU1 EF hands determine MCU activity, but not binding.
23747253 Prolonged MICU1 loss leads to an adaptive increase in matrix Ca(2+) binding, yet cells show impaired oxidative metabolism and sensitization to Ca(2+) overload.
23667653 CBARA1 is a marker for undifferentiated human embryonic stem cells that plays a role in maintaining stemness, cell cycle progression, and proliferation.
23615904 MICU1 is a novel regulator of the machinery in cancer cells that prevents apoptosis.
More...

AA Sequence

MFRLNSLSALAELAVGSRWYHGGSQPIQIRRRLMMVAFLGASAVTASTGLLWKRAHAESPPCVDNLKSDI      1 - 70
GDKGKNKDEGDVCNHEKKTADLAPHPEEKKKKRSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVISEP     71 - 140
GEAEVFMTPEDFVRSITPNEKQPEHLGLDQYIIKRFDGKKISQEREKFADEGSIFYTLGECGLISFSDYI    141 - 210
FLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALTT    211 - 280
YFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRITERQFGGMLLAYSGVQSKKLTAMQRQLK    281 - 350
KHFKEGKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQQVARTVAKVELSDHVCDVVFALF    351 - 420
DCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLMQAMWKCAQETAWDFALPKQ                  421 - 476
//

Text Mined References (41)

PMID Year Title
27123478 2016 Homozygous deletion in MICU1 presenting with fatigue and lethargy in childhood.
27099988 2016 Dual functions of a small regulatory subunit in the mitochondrial calcium uniporter complex.
26903221 2016 Functional roles of MICU1 and MICU2 in mitochondrial Ca(2+) uptake.
26774479 2016 EMRE Is a Matrix Ca(2+) Sensor that Governs Gatekeeping of the Mitochondrial Ca(2+) Uniporter.
26489515 2015 Rearrangement of MICU1 multimers for activation of MCU is solely controlled by cytosolic Ca(2.).
26387864 2015 The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake.
26341627 2015 Structure and function of the N-terminal domain of the human mitochondrial calcium uniporter.
26336993 2015 RPS3 regulates melanoma cell growth and apoptosis by targeting Cyto C/Ca2+/MICU1 dependent mitochondrial signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25824785 2015 Loss of heterozygosity at the calcium regulation gene locus on chromosome 10q in human pancreatic cancer.
More...