Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.49
PubTator Score 0.51

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9BPX5 Q7Z523
Symbols ARC16-2

Gene

AA Sequence

MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAAEPGPDPSEVDGLLRQGDMLRAFHAALRNSPVNTKN      1 - 70
QAVKERAQGVVLKVLTNFKSSEIEQAVQSLDRNGVDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGL     71 - 140
GSIIRVLTARKTV                                                             141 - 153
//

Text Mined References (19)

PMID Year Title
26655834 2016 Isoform diversity in the Arp2/3 complex determines actin filament dynamics.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21269460 2011 Initial characterization of the human central proteome.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...