Property Summary

NCBI Gene PubMed Count 23
PubMed Score 36.14
PubTator Score 6.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma 1.752 1.4e-04
adult high grade glioma 1.600 3.5e-03
Atopic dermatitis 2.500 1.4e-05
atypical teratoid / rhabdoid tumor 2.200 2.6e-08
Breast cancer 2.300 2.7e-02
breast carcinoma 2.100 4.4e-06
colon cancer 1.200 1.4e-02
ductal carcinoma in situ 1.600 1.7e-03
Endometriosis 1.484 4.7e-02
ependymoma 1.100 3.2e-04
glioblastoma 2.300 5.2e-09
group 3 medulloblastoma 3.800 7.2e-08
interstitial cystitis 1.100 6.0e-03
intraductal papillary-mucinous carcinoma... 2.700 5.4e-05
intraductal papillary-mucinous neoplasm ... 3.200 4.0e-05
invasive ductal carcinoma 2.000 2.1e-03
lung adenocarcinoma 1.100 1.1e-06
lung cancer 3.100 1.5e-05
malignant mesothelioma 1.100 1.2e-06
medulloblastoma, large-cell 2.900 4.4e-07
nasopharyngeal carcinoma 1.700 1.3e-05
non-small cell lung cancer 2.292 6.0e-25
osteosarcoma -3.259 3.0e-03
ovarian cancer 2.200 5.8e-06
pancreatic cancer 1.200 6.7e-03
pancreatic carcinoma 1.200 6.7e-03
pancreatic ductal adenocarcinoma liver m... 1.559 3.7e-02
primary Sjogren syndrome 1.100 9.8e-03
primitive neuroectodermal tumor 2.700 1.1e-05
psoriasis -1.300 1.0e-02

Gene RIF (3)

AA Sequence

MGAERRLLSIKEAFRLAQQPHQNQAKLVVALSRTYRTMDDKTVFHEEFIHYLKYVMVVYKREPAVERVIE      1 - 70
FAAKFVTSFHQSDMEDDEEEEDGGLLNYLFTFLLKSHEANSNAVRFRVCLLINKLLGSMPENAQIDDDVF     71 - 140
DKINKAMLIRLKDKIPNVRIQAVLALSRLQDPKDDECPVVNAYATLIENDSNPEVRRAVLSCIAPSAKTL    141 - 210
PKIVGRTKDVKEAVRKLAYQVLAEKVHMRAMSIAQRVMLLQQGLNDRSDAVKQAMQKHLLQGWLRFSEGN    211 - 280
ILELLHRLDVENSSEVAVSVLNALFSITPLSELVGLCKNNDGRKLIPVETLTPEIALYWCALCEYLKSKG    281 - 350
DEGEEFLEQILPEPVVYADYLLSYIQSIPVVNEEHRGDFSYIGNLMTKEFIGQQLILIIKSLDTSEEGGR    351 - 420
KKLLAVLQEILILPTIPISLVSFLVERLLHIIIDDNKRTQIVTEIISEIRAPIVTVGVNNDPADVRKKEL    421 - 490
KMAEIKVKLIEAKEALENCITLQDFNRASELKEEIKALEDARINLLKETEQLEIKEVHIEKNDAETLQKC    491 - 560
LILCYELLKQMSISTGLSATMNGIIESLILPGIISIHPVVRNLAVLCLGCCGLQNQDFARKHFVLLLQVL    561 - 630
QIDDVTIKISALKAIFDQLMTFGIEPFKTKKIKTLHCEGTEINSDDEQESKEVEETATAKNVLKLLSDFL    631 - 700
DSEVSELRTGAAEGLAKLMFSGLLVSSRILSRLILLWYNPVTEEDVQLRHCLGVFFPVFAYASRTNQECF    701 - 770
EEAFLPTLQTLANAPASSPLAEIDITNVAELLVDLTRPSGLNPQAKTSQDYQALTVHDNLAMKICNEILT    771 - 840
SPCSPEIRVYTKALSSLELSSHLAKDLLVLLNEILEQVKDRTCLRALEKIKIQLEKGNKEFGDQAEAAQD    841 - 910
ATLTTTTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSESDHEVP    911 - 980
EPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS                                       981 - 1015
//

Text Mined References (34)

PMID Year Title