Property Summary

NCBI Gene PubMed Count 22
PubMed Score 32.03
PubTator Score 6.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
psoriasis 6685 4.60124474754309E-137
non-small cell lung cancer 2798 1.70831088247832E-26
sonic hedgehog group medulloblastoma 1482 1.63485444850743E-11
atypical teratoid / rhabdoid tumor 4369 7.14164184465826E-11
lung adenocarcinoma 2714 1.70945396056734E-8
medulloblastoma, large-cell 6234 6.64962830229381E-8
glioblastoma 5572 4.69256554890961E-7
pediatric high grade glioma 2712 4.77348055037253E-7
malignant mesothelioma 3163 5.68254613289745E-7
primitive neuroectodermal tumor 3031 7.16843036412233E-7
lung cancer 4473 3.33704915539418E-6
breast carcinoma 1614 4.43303230329704E-6
ovarian cancer 8492 5.78980466897063E-6
nasopharyngeal carcinoma 1056 1.32666436580833E-5
Atopic dermatitis 944 1.41757118855921E-5
inflammatory breast cancer 404 2.11110786667625E-5
posterior fossa group A ependymoma 1511 3.51243091284783E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.96910398050969E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 5.40960314952399E-5
adrenocortical carcinoma 1427 9.56053031762533E-4
invasive ductal carcinoma 2950 0.00151564984740131
ductal carcinoma in situ 1745 0.00174586181762223
osteosarcoma 7933 0.0029799509791123
colon cancer 1475 0.00417821172779838
interstitial cystitis 2299 0.00602075911043592
pancreatic cancer 2300 0.00673609418658953
pancreatic carcinoma 567 0.00673609418658953
primary Sjogren syndrome 789 0.00979021847676412
Endometriosis 535 0.0188405264978712
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0370883304863925
Disease Target Count Z-score Confidence
Croup 12 3.572 1.8

Expression

Synonym

Accession Q9BPX3 Q3MJE0 Q96SV9 Q9BUR3 Q9BVY1 Q9H914 Q9H9Z6 Q9HBI9
Symbols CAPG
CHCG
YCG1
NY-MEL-3

Gene

  Ortholog (14)

 GWAS Trait (1)

Gene RIF (2)

PMID Text
20546612 Observational study of gene-disease association. (HuGE Navigator)
18977199 Mutation of threonines 308 and 322 to alanines results in defects in CAP-G localization with chromosomes during mitosis.

AA Sequence

MGAERRLLSIKEAFRLAQQPHQNQAKLVVALSRTYRTMDDKTVFHEEFIHYLKYVMVVYKREPAVERVIE      1 - 70
FAAKFVTSFHQSDMEDDEEEEDGGLLNYLFTFLLKSHEANSNAVRFRVCLLINKLLGSMPENAQIDDDVF     71 - 140
DKINKAMLIRLKDKIPNVRIQAVLALSRLQDPKDDECPVVNAYATLIENDSNPEVRRAVLSCIAPSAKTL    141 - 210
PKIVGRTKDVKEAVRKLAYQVLAEKVHMRAMSIAQRVMLLQQGLNDRSDAVKQAMQKHLLQGWLRFSEGN    211 - 280
ILELLHRLDVENSSEVAVSVLNALFSITPLSELVGLCKNNDGRKLIPVETLTPEIALYWCALCEYLKSKG    281 - 350
DEGEEFLEQILPEPVVYADYLLSYIQSIPVVNEEHRGDFSYIGNLMTKEFIGQQLILIIKSLDTSEEGGR    351 - 420
KKLLAVLQEILILPTIPISLVSFLVERLLHIIIDDNKRTQIVTEIISEIRAPIVTVGVNNDPADVRKKEL    421 - 490
KMAEIKVKLIEAKEALENCITLQDFNRASELKEEIKALEDARINLLKETEQLEIKEVHIEKNDAETLQKC    491 - 560
LILCYELLKQMSISTGLSATMNGIIESLILPGIISIHPVVRNLAVLCLGCCGLQNQDFARKHFVLLLQVL    561 - 630
QIDDVTIKISALKAIFDQLMTFGIEPFKTKKIKTLHCEGTEINSDDEQESKEVEETATAKNVLKLLSDFL    631 - 700
DSEVSELRTGAAEGLAKLMFSGLLVSSRILSRLILLWYNPVTEEDVQLRHCLGVFFPVFAYASRTNQECF    701 - 770
EEAFLPTLQTLANAPASSPLAEIDITNVAELLVDLTRPSGLNPQAKTSQDYQALTVHDNLAMKICNEILT    771 - 840
SPCSPEIRVYTKALSSLELSSHLAKDLLVLLNEILEQVKDRTCLRALEKIKIQLEKGNKEFGDQAEAAQD    841 - 910
ATLTTTTFQNEDEKNKEVYMTPLRGVKATQASKSTQLKTNRGQRKVTVSARTNRRCQTAEADSESDHEVP    911 - 980
EPESEMKMRLPRRAKTAALEKSKLNLAQFLNEDLS                                       981 - 1015
//

Text Mined References (33)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20546612 2010 The role of height-associated loci identified in genome wide association studies in the determination of pediatric stature.
20189936 2010 A genome-wide association study in 19 633 Japanese subjects identified LHX3-QSOX2 and IGF1 as adult height loci.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
More...