Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.28
PubTator Score 4.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
malignant mesothelioma 3163 3.77600848500732E-7
group 4 medulloblastoma 1875 1.13133086717935E-6
medulloblastoma, large-cell 6234 0.00120552199575122
subependymal giant cell astrocytoma 2287 0.013161328708013
Disease Target Count Z-score Confidence
estrogen-receptor positive breast cancer 7 3.627 1.8

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma 1.900 0.000
group 4 medulloblastoma -1.500 0.000
medulloblastoma, large-cell -1.400 0.001
subependymal giant cell astrocytoma 2.686 0.013

Synonym

Accession Q9BPX1 Q9UKU3 17-beta-HSD 14
Symbols DHRS10
SDR47C1
retSDR3

Gene

PDB

1YDE   5HS6   5ICM   5ICS   5JS6   5JSF  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Anole lizard OMA Inparanoid
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
22792371 Results show that tumoural expression levels of 17betaHSD14 can predict the outcome of adjuvant tamoxifen treatment in terms of local recurrence-free survival in patients with lymph node-negative ER+ breast cancer.
17067289 crystal structure of the DHRS10 apoenzyme exhibits secondary structure of the SDR (short-chain dehydrogenase/reductase) family

AA Sequence

MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVK      1 - 70
TLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINIS     71 - 140
SLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGM    141 - 210
LAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS              211 - 270
//

Text Mined References (13)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25416956 2014 A proteome-scale map of the human interactome network.
22792371 2012 17?-Hydroxysteroid dehydrogenase type 14 is a predictive marker for tamoxifen response in oestrogen receptor positive breast cancer.
19060904 2009 An empirical framework for binary interactome mapping.
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17067289 2007 Structural and biochemical characterization of human orphan DHRS10 reveals a novel cytosolic enzyme with steroid dehydrogenase activity.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...