Property Summary

Ligand Count 1
NCBI Gene PubMed Count 15
PubMed Score 5.51
PubTator Score 4.75

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.100 3.7e-03
malignant mesothelioma 1.900 3.8e-07
medulloblastoma, large-cell -1.100 1.8e-03
subependymal giant cell astrocytoma 2.312 2.6e-02

Synonym

Accession Q9BPX1 Q9UKU3 17-beta-HSD 14
Symbols DHRS10
SDR47C1
retSDR3

Gene

PANTHER Protein Class (2)

PDB

1YDE   5EN4   5HS6   5ICM   5ICS   5JS6   5JSF   5L7T   5L7W   5L7Y  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MATGTRYAGKVVVVTGGGRGIGAGIVRAFVNSGARVVICDKDESGGRALEQELPGAVFILCDVTQEDDVK      1 - 70
TLVSETIRRFGRLDCVVNNAGHHPPPQRPEETSAQGFRQLLELNLLGTYTLTKLALPYLRKSQGNVINIS     71 - 140
SLVGAIGQAQAVPYVATKGAVTAMTKALALDESPYGVRVNCISPGNIWTPLWEELAALMPDPRATIREGM    141 - 210
LAQPLGRMGQPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIPS              211 - 270
//

Text Mined References (15)

PMID Year Title