Property Summary

NCBI Gene PubMed Count 14
Grant Count 15
R01 Count 4
Funding $2,035,107.4
PubMed Score 299.38
PubTator Score 11.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
astrocytic glioma -1.300 0.035
ependymoma -2.300 0.011
oligodendroglioma -1.500 0.030
permanent atrial fibrillation 1.300 0.000
cutaneous lupus erythematosus 1.600 0.007
psoriasis 2.900 0.002
glioblastoma multiforme -1.100 0.000
osteosarcoma -3.064 0.000
tuberculosis and treatment for 6 months -3.100 0.000
intraductal papillary-mucinous neoplasm ... 4.700 0.001
colon cancer -2.800 0.000
lung cancer -2.000 0.001
active Crohn's disease -2.113 0.024
pancreatic cancer 2.200 0.001
Multiple Sclerosis 1.100 0.038
interstitial cystitis 2.400 0.015
cystic fibrosis 2.600 0.000
group 3 medulloblastoma -1.300 0.003
sarcoidosis 1.200 0.000
nasopharyngeal carcinoma -2.900 0.000
lung carcinoma -1.400 0.000
mucosa-associated lymphoid tissue lympho... 1.167 0.028
pituitary cancer 1.100 0.031

Gene RIF (5)

PMID Text
27239845 Even at early stages of malignant transformation, a significant decrease in ADH1B, ADH3, RDHL, and RALDH1 mRNA levels was observed in 82, 79, 73, and 64% of tumor specimens, respectively
23383108 A synthetic peptide corresponding to the immunosuppressive domain (amino acids 574-592) of HIV-1 gp41 downregulates the expression of dehydrogenase/reductase (SDR family) member 9 (DHRS9) in peptide-treated PBMCs
17244623 retinoic acid-responsive genes are induced by Epstein-Barr virus lytic infection through induction of a retinol-metabolizing enzyme, DHRS9
16691198 Dehydrogenase/reductase SDR family member 9 is a moonlighting protein that functions as both a metabolic enzyme and as a transcriptional repressor.
15190067 expression of retinol dehydrogenase L is regulated by APC and CDX2

AA Sequence

MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALK      1 - 70
AETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFG     71 - 140
LISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFK    141 - 210
TNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTH    211 - 280
YAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV                                   281 - 319
//

Text Mined References (16)

PMID Year Title
27239845 [Abnormal expression of genes that regulate retinoid metabolism and signaling in non-small-cell lung cancer].
19027726 2009 The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.
17244623 2007 Epstein-Barr virus lytic infection induces retinoic acid-responsive genes through induction of a retinol-metabolizing enzyme, DHRS9.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16691198 2006 A metabolic enzyme of the short-chain dehydrogenase/reductase superfamily may moonlight in the nucleus as a repressor of promoter activity.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15190067 2004 The tumor suppressor adenomatous polyposis coli and caudal related homeodomain protein regulate expression of retinol dehydrogenase L.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...