Property Summary

NCBI Gene PubMed Count 16
PubMed Score 300.80
PubTator Score 11.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active Crohn's disease -1.689 3.3e-02
astrocytic glioma -1.300 3.5e-02
colon cancer -2.500 1.3e-02
cutaneous lupus erythematosus 1.600 6.9e-03
cystic fibrosis 2.500 3.4e-04
ependymoma -1.300 4.1e-02
glioblastoma multiforme -1.100 3.7e-22
group 3 medulloblastoma -1.300 3.1e-03
interstitial cystitis 2.000 1.3e-02
intraductal papillary-mucinous neoplasm ... 4.700 6.6e-04
lung cancer -2.000 7.3e-04
lung carcinoma -1.400 8.2e-09
mucosa-associated lymphoid tissue lympho... 1.167 2.8e-02
Multiple Sclerosis 1.100 3.8e-02
nasopharyngeal carcinoma -2.900 7.2e-08
oligodendroglioma -1.500 3.0e-02
osteosarcoma -1.712 1.3e-04
pancreatic cancer 1.600 1.4e-03
permanent atrial fibrillation 1.100 2.0e-04
pituitary cancer 1.100 3.1e-02
psoriasis 2.900 1.5e-03
sarcoidosis 1.200 3.0e-05
tuberculosis -1.800 1.1e-05

Protein-protein Interaction (10)

Gene RIF (7)

AA Sequence

MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALK      1 - 70
AETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFG     71 - 140
LISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFK    141 - 210
TNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTH    211 - 280
YAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV                                   281 - 319
//

Text Mined References (18)

PMID Year Title