Property Summary

NCBI Gene PubMed Count 14
Grant Count 2
Funding $25,866
PubMed Score 7.77
PubTator Score 4.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ependymoma -1.100 0.010
pancreatic ductal adenocarcinoma liver m... -1.235 0.022
non-small cell lung cancer 1.488 0.000
lung cancer 2.800 0.000
adult high grade glioma -1.100 0.003
lung carcinoma 1.100 0.000

Gene RIF (5)

PMID Text
24137763 NIPSNAP1 mutations could not explain phenotype of patients with combined oxidative phosphorylation system deficiencies.
23792589 Structural variants unique to the malignant cell line inactivated: gene NIPSNAP1, putative tumor suppressor that inhibits TRPV6, an anti-apoptotic oncogene implicated in prostate cancer progression.
22311985 NIPSNAP1 is an interacting molecule of NST and plays a crucial role in pain transmission.
20877624 Observational study of gene-disease association. (HuGE Navigator)
18392847 This study presents the first physiological function of mouse Nipsnap1 as an associated protein inhibiting transient receptor potential vanilloid channel 6 activity that possibly exerts its effect directly at the plasma membrane.

AA Sequence

MAPRLCSISVTARRLLGGPGPRAGDVASAAAARFYSKDNEGSWFRSLFVHKVDPRKDAHSTLLSKKETSN      1 - 70
LYKIQFHNVKPEYLDAYNSLTEAVLPKLHLDEDYPCSLVGNWNTWYGEQDQAVHLWRFSGGYPALMDCMN     71 - 140
KLKNNKEYLEFRRERSQMLLSRRNQLLLEFSFWNEPQPRMGPNIYELRTYKLKPGTMIEWGNNWARAIKY    141 - 210
RQENQEAVGGFFSQIGELYVVHHLWAYKDLQSREETRNAAWRKRGWDENVYYTVPLVRHMESRIMIPLKI    211 - 280
SPLQ                                                                      281 - 284
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25126726 2014 FLCN, a novel autophagy component, interacts with GABARAP and is regulated by ULK1 phosphorylation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24137763 2010 Sequence variants in four candidate genes (NIPSNAP1, GBAS, CHCHD1 and METT11D1) in patients with combined oxidative phosphorylation system deficiencies.
23792589 2013 Chromosomal structural variations during progression of a prostate epithelial cell line to a malignant metastatic state inactivate the NF2, NIPSNAP1, UGT2B17, and LPIN2 genes.
22311985 2012 Identification of NIPSNAP1 as a nocistatin-interacting protein involving pain transmission.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20562859 2010 Network organization of the human autophagy system.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
More...