Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.37
PubTator Score 1.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.400 3.5e-03
astrocytic glioma -1.600 1.5e-02
atypical teratoid / rhabdoid tumor -2.600 3.7e-10
ductal carcinoma in situ 1.200 6.8e-03
ependymoma -1.900 3.9e-02
glioblastoma -1.300 4.3e-03
group 3 medulloblastoma -1.500 1.5e-02
interstitial cystitis -1.300 8.2e-04
lung cancer 5.500 1.9e-05
oligodendroglioma -1.800 1.2e-02
Pilocytic astrocytoma -1.100 5.0e-03
primitive neuroectodermal tumor -1.600 9.5e-05
psoriasis -2.000 1.9e-04
subependymal giant cell astrocytoma -1.277 2.6e-02

Gene RIF (1)

AA Sequence

MRLIQNMCTIAEYPAPGNAAASDCCVGAAGRRLVKIAVVGASGVGKTALVVRFLTKRFIGDYERNAGNLY      1 - 70
TRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQLHQHVQQLH     71 - 140
LGTRLPVVVVANKADLLHIKQVDPQLGLQLASMLGCSFYEVSVSENYNDVYSAFHVLCKEVSHKQQPSST    141 - 210
PEKRRTSLIPRPKSPNMQDLKRRFKQALSAKVRTVTSV                                    211 - 248
//

Text Mined References (6)

PMID Year Title