Property Summary

NCBI Gene PubMed Count 5
PubMed Score 2.32
PubTator Score 1.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.600 0.015
posterior fossa group A ependymoma -2.400 0.000
oligodendroglioma -1.800 0.012
psoriasis -2.000 0.000
glioblastoma -2.100 0.001
group 4 medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
primitive neuroectodermal tumor -1.600 0.000
lung cancer 5.500 0.000
interstitial cystitis -1.600 0.000
pediatric high grade glioma -1.500 0.003
pilocytic astrocytoma -1.100 0.005
subependymal giant cell astrocytoma -1.277 0.026
ductal carcinoma in situ 1.200 0.007

Gene RIF (1)

PMID Text
17628721 RASL11B gene is expressed in all tissues investigated, with highest levels in placenta & primary macrophages. RASL11B may play a role in TGF-beta1-mediated developmental processes & in pathophysiologies such as inflammation, cancer, and arteriosclerosis.

AA Sequence

MRLIQNMCTIAEYPAPGNAAASDCCVGAAGRRLVKIAVVGASGVGKTALVVRFLTKRFIGDYERNAGNLY      1 - 70
TRQVQIEGETLALQVQDTPGIQVHENSLSCSEQLNRCIRWADAVVIVFSITDYKSYELISQLHQHVQQLH     71 - 140
LGTRLPVVVVANKADLLHIKQVDPQLGLQLASMLGCSFYEVSVSENYNDVYSAFHVLCKEVSHKQQPSST    141 - 210
PEKRRTSLIPRPKSPNMQDLKRRFKQALSAKVRTVTSV                                    211 - 248
//

Text Mined References (6)

PMID Year Title
17628721 Cloning, genomic organization, and tissue-specific expression of the RASL11B gene.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15033445 2004 RASL11A, member of a novel small monomeric GTPase gene family, is down-regulated in prostate tumors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.