Property Summary

NCBI Gene PubMed Count 10
PubMed Score 0.50
PubTator Score 0.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.951 0.000
sonic hedgehog group medulloblastoma 2.800 0.000
adult high grade glioma 1.300 0.004
posterior fossa group A ependymoma 1.200 0.001
Endometriosis -1.289 0.017
pituitary cancer -2.800 0.000

Gene RIF (4)

PMID Text
18632255 An association of APOL1, 2 and 4 with schizophrenia was establised.
18632255 Observational study of gene-disease association. (HuGE Navigator)
15949655 Observational study of gene-disease association. (HuGE Navigator)
11944986 APOL4 has been found only in humans and African green monkeys

AA Sequence

MEGAALLKIFVVCIWVQQNHPGWTVAGQFQEKKRFTEEVIEYFQKKVSPVHLKILLTSDEAWKRFVRVAE      1 - 70
LPREEADALYEALKNLTPYVAIEDKDMQQKEQQFREWFLKEFPQIRWKIQESIERLRVIANEIEKVHRGC     71 - 140
VIANVVSGSTGILSVIGVMLAPFTAGLSLSITAAGVGLGIASATAGIASSIVENTYTRSAELTASRLTAT    141 - 210
STDQLEALRDILRDITPNVLSFALDFDEATKMIANDVHTLRRSKATVGRPLIAWRYVPINVVETLRTRGA    211 - 280
PTRIVRKVARNLGKATSGVLVVLDVVNLVQDSLDLHKGAKSESAESLRQWAQELEENLNELTHIHQSLKA    281 - 350
G//

Text Mined References (10)

PMID Year Title
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
18632255 2008 Association of SNPs and haplotypes in APOL1, 2 and 4 with schizophrenia.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15949655 2005 Investigation of the apolipoprotein-L (APOL) gene family and schizophrenia using a novel DNA pooling strategy for public database SNPs.
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11944986 2002 The apolipoprotein L gene cluster has emerged recently in evolution and is expressed in human vascular tissue.
11374903 2001 The human apolipoprotein L gene cluster: identification, classification, and sites of distribution.
11290834 2001 Apolipoprotein L gene family: tissue-specific expression, splicing, promoter regions; discovery of a new gene.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.