Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.68
PubTator Score 4.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Meckel-Gruber syndrome 13
Disease Target Count Z-score Confidence
Joubert syndrome 66 5.103 2.6
Disease Target Count Z-score Confidence
Nephronophthisis 80 4.461 2.2
Polydactyly 107 4.142 2.1
Coloboma 51 3.051 1.5

Expression

 GO Function (1)

 GWAS Trait (1)

Protein-protein Interaction (7)

Gene RIF (6)

AA Sequence

MAEVHVIGQIIGASGFSESSLFCKWGIHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGL      1 - 70
QGWPRLHFQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLACPTWRPLGSWREQLARAFVGGGPQLLHGDTI     71 - 140
YSGADRYRLHTAAGGTVHLEIGLLLRNFDRYGVEC                                       141 - 175
//

Text Mined References (18)

PMID Year Title