Property Summary

NCBI Gene PubMed Count 23
PubMed Score 101.50
PubTator Score 86.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
medulloblastoma 1.800 0.001
atypical teratoid / rhabdoid tumor 1.300 0.004
glioblastoma 1.100 0.024
primitive neuroectodermal tumor 1.600 0.001
ovarian cancer -1.200 0.000
pituitary cancer 1.300 0.000

Gene RIF (11)

PMID Text
26122847 Our findings suggest that CRMP5 serves as a major mediator of Notch signaling and Akt activation by controlling the degradation of the Notch receptor, with implications for defining a biomarker signature in glioblastoma
24695578 present study suggested that CRAM could be a clinical prognostic marker for patients with cervical cancer
24324268 study elucidates a novel regulatory mechanism that utilizes CRMP5-induced mitophagy to orchestrate proper dendrite outgrowth and neuronal function.
23373749 identified residues that are crucial for determining the preference for hetero-oligomer or homo-oligomer formation. In spite of being the CRMP family member most closely related to dihydropyrimidinase, CRMP-5 does not have amidohydrolase activity.
23298946 New CRMP5 isoform present in the nucleus is associated with Glioma.
18931014 patients with CV2/CRMP5-Ab and thymoma developed myasthenic syndrome more frequently
18854154 Knockdown of dihydropyrimidinase-like 5 (DPYSL5) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18769332 findings point at CRMP5 as a novel marker for distinguishing between highly aggressive neuroendocrine carcinoma and the other lung cancers.
18347453 We describe a patient with optic neuropathy and vitritis as the only clinical manifestations of paraneoplastic optic neuropathy secondary to lung cancer marked by an extremely high titer of CRMP-5 antibody.
18306241 CRMP-5 autoimmune myelopathy and occult neoplasia are important considerations in patients with insidiously progressive myelopathy, especially with known cancer risk.
More...

AA Sequence

MLANSASVRILIKGGKVVNDDCTHEADVYIENGIIQQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFH      1 - 70
QTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDKETSLVDAYEKCRGLADPKVCCDYALHVGITWWAPK     71 - 140
VKAEMETLVREKGVNSFQMFMTYKDLYMLRDSELYQVLHACKDIGAIARVHAENGELVAEGAKEALDLGI    141 - 210
TGPEGIEISRPEELEAEATHRVITIANRTHCPIYLVNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTG    211 - 280
LHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLANDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSG    281 - 350
VQDRMSVIWERGVVGGKMDENRFVAVTSSNAAKLLNLYPRKGRIIPGADADVVVWDPEATKTISASTQVQ    351 - 420
GGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCAEGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRT    421 - 490
PYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGMRDLHESSFSLSGSQIDDHVPKRASARILAPPGGRS    491 - 560
SGIW                                                                      561 - 564
//

Text Mined References (25)

PMID Year Title
26122847 2015 CRMP5 Controls Glioblastoma Cell Proliferation and Survival through Notch-Dependent Signaling.
25416956 2014 A proteome-scale map of the human interactome network.
24695578 2014 High expression of CRAM correlates with poor prognosis in patients with cervical carcinoma.
24324268 2014 Collapsin response mediator protein 5 (CRMP5) induces mitophagy, thereby regulating mitochondrion numbers in dendrites.
23373749 2013 Insights into the oligomerization of CRMPs: crystal structure of human collapsin response mediator protein 5.
23298946 2013 Identification of a new CRMP5 isoform present in the nucleus of cancer cells and enhancing their proliferation.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
21269460 2011 Initial characterization of the human central proteome.
18931014 2009 Onco-neural antibodies and tumour type determine survival and neurological symptoms in paraneoplastic neurological syndromes with Hu or CV2/CRMP5 antibodies.
More...