Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.80
PubTator Score 9.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 5.5e-42
pituitary cancer 1972 4.5e-07
Astrocytoma, Pilocytic 3081 2.5e-04
group 3 medulloblastoma 4104 1.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (4)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 2.5e-04
group 3 medulloblastoma -1.300 1.2e-02
pituitary cancer 1.400 4.5e-07
psoriasis -2.200 5.5e-42

Protein-protein Interaction (6)

Gene RIF (1)

AA Sequence

MLPPQKKPWESMAKGLVLGALFTSFLLLVYSYAVPPLHAGLASTTPEAAASCSPPALEPEAVIRANGSAG      1 - 70
ECQPRRNIVFLKTHKTASSTLLNILFRFGQKHRLKFAFPNGRNDFDYPTFFARSLVQDYRPGACFNIICN     71 - 140
HMRFHYDEVRGLVPTNAIFITVLRDPARLFESSFHYFGPVVPLTWKLSAGDKLTEFLQDPDRYYDPNGFN    141 - 210
AHYLRNLLFFDLGYDNSLDPSSPQVQEHILEVERRFHLVLLQEYFDESLVLLKDLLCWELEDVLYFKLNA    211 - 280
RRDSPVPRLSGELYGRATAWNMLDSHLYRHFNASFWRKVEAFGRERMAREVAALRHANERMRTICIDGGH    281 - 350
AVDAAAIQDEAMQPWQPLGTKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLMDLGANLWVTKLWKFIRDF    351 - 420
LRW                                                                       421 - 423
//

Text Mined References (18)

PMID Year Title