Property Summary

NCBI Gene PubMed Count 18
Grant Count 3
Funding $165,866
PubMed Score 12.33
PubTator Score 9.92

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.300 0.012
pilocytic astrocytoma 1.500 0.000
pituitary cancer 1.400 0.000
psoriasis -2.200 0.000

Synonym

Accession Q99999 Q96C63 GalCer sulfotransferase
Symbols CST

Gene

Gene RIF (1)

PMID Text
19587831 results suggest that heterozygosity at SNP rs2267161 in the gene encoding the CST enzyme confers increased risk of type 2 diabetes; females with the CC allele showed lower insulin resistance

AA Sequence

MLPPQKKPWESMAKGLVLGALFTSFLLLVYSYAVPPLHAGLASTTPEAAASCSPPALEPEAVIRANGSAG      1 - 70
ECQPRRNIVFLKTHKTASSTLLNILFRFGQKHRLKFAFPNGRNDFDYPTFFARSLVQDYRPGACFNIICN     71 - 140
HMRFHYDEVRGLVPTNAIFITVLRDPARLFESSFHYFGPVVPLTWKLSAGDKLTEFLQDPDRYYDPNGFN    141 - 210
AHYLRNLLFFDLGYDNSLDPSSPQVQEHILEVERRFHLVLLQEYFDESLVLLKDLLCWELEDVLYFKLNA    211 - 280
RRDSPVPRLSGELYGRATAWNMLDSHLYRHFNASFWRKVEAFGRERMAREVAALRHANERMRTICIDGGH    281 - 350
AVDAAAIQDEAMQPWQPLGTKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLMDLGANLWVTKLWKFIRDF    351 - 420
LRW                                                                       421 - 423
//

Text Mined References (18)

PMID Year Title
20624317 2010 Elevation of sulfatides in ovarian cancer: an integrated transcriptomic and lipidomic analysis including tissue-imaging mass spectrometry.
19587831 2009 A variation in the cerebroside sulfotransferase gene is linked to exercise-modified insulin resistance and to type 2 diabetes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12175333 2002 N-glycosylation is required for full enzymic activity of the murine galactosylceramide sulphotransferase.
10785389 2000 Cancer-associated alternative usage of multiple promoters of human GalCer sulfotransferase gene.
9847074 1998 Toward a complete human genome sequence.
More...