Property Summary

NCBI Gene PubMed Count 18
Grant Count 3
Funding $165,866
PubMed Score 12.33
PubTator Score 9.92

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
group 3 medulloblastoma -1.300 0.012
pilocytic astrocytoma 1.500 0.000
pituitary cancer 1.400 0.000
psoriasis -2.200 0.000

Synonym

Accession Q99999 Q96C63 GalCer sulfotransferase
Symbols CST

Gene

Protein-protein Interaction (6)

Gene RIF (1)

PMID Text
19587831 results suggest that heterozygosity at SNP rs2267161 in the gene encoding the CST enzyme confers increased risk of type 2 diabetes; females with the CC allele showed lower insulin resistance

AA Sequence

MLPPQKKPWESMAKGLVLGALFTSFLLLVYSYAVPPLHAGLASTTPEAAASCSPPALEPEAVIRANGSAG      1 - 70
ECQPRRNIVFLKTHKTASSTLLNILFRFGQKHRLKFAFPNGRNDFDYPTFFARSLVQDYRPGACFNIICN     71 - 140
HMRFHYDEVRGLVPTNAIFITVLRDPARLFESSFHYFGPVVPLTWKLSAGDKLTEFLQDPDRYYDPNGFN    141 - 210
AHYLRNLLFFDLGYDNSLDPSSPQVQEHILEVERRFHLVLLQEYFDESLVLLKDLLCWELEDVLYFKLNA    211 - 280
RRDSPVPRLSGELYGRATAWNMLDSHLYRHFNASFWRKVEAFGRERMAREVAALRHANERMRTICIDGGH    281 - 350
AVDAAAIQDEAMQPWQPLGTKSILGYNLKKSIGQRHAQLCRRMLTPEIQYLMDLGANLWVTKLWKFIRDF    351 - 420
LRW                                                                       421 - 423
//

Publication (18)

PMID Year Title
20624317 2010 Elevation of sulfatides in ovarian cancer: an integrated transcriptomic and lipidomic analysis including tissue-imaging mass spectrometry.
19587831 2009 A variation in the cerebroside sulfotransferase gene is linked to exercise-modified insulin resistance and to type 2 diabetes.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12175333 2002 N-glycosylation is required for full enzymic activity of the murine galactosylceramide sulphotransferase.
10785389 2000 Cancer-associated alternative usage of multiple promoters of human GalCer sulfotransferase gene.
9847074 1998 Toward a complete human genome sequence.
More...