Property Summary

NCBI Gene PubMed Count 239
PubMed Score 660.65
PubTator Score 615.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 5.06538509127384E-19
non-small cell lung carcinoma 413 6.41344353334235E-10
juvenile dermatomyositis 1189 4.23422756041772E-5
Breast cancer 3099 1.10027053921648E-4
lung adenocarcinoma 2714 1.25089099649395E-4
lung cancer 4473 8.80281143889009E-4
nephrosclerosis 329 9.75225023075233E-4
atypical teratoid / rhabdoid tumor 4369 0.00117066286879349
glioblastoma 5572 0.00125112583990803
pediatric high grade glioma 2712 0.00140130313996031
ovarian cancer 8492 0.00443521925577096
posterior fossa group A ependymoma 1511 0.00530673581037954
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00553642949417211
sarcoidosis 368 0.00607550044115042
nasopharyngeal carcinoma 1056 0.00668555158203542
breast carcinoma 1614 0.00963516891197004
invasive ductal carcinoma 2950 0.0119074706950342
colon cancer 1475 0.0125972277560015
esophageal adenocarcinoma 737 0.019875151946297
gastric carcinoma 832 0.0209883889002071
ductal carcinoma in situ 1745 0.0233156779310955
osteosarcoma 7933 0.0250423086894687
active ulcerative colitis 477 0.0269111473933505
COPD 116 0.0281489418019095
subependymal giant cell astrocytoma 2287 0.0405890190568734
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0415939829485087
Disease Target Count Z-score Confidence
Cancer 2346 4.537 2.3
Heart disease 279 3.541 1.8
Anemia 252 3.301 1.7
Thalassemia 46 3.126 1.6

Expression

Synonym

Accession Q99988 O14629 P78360 Q9BWA0 Q9NRT0 GDF-15
Symbols PDF
MIC1
PLAB
MIC-1
NAG-1
PTGFB
GDF-15

Gene

PANTHER Protein Class (2)

  Ortholog (6)

 IMPC Term (1)

Gene RIF (231)

PMID Text
27069189 We identified five new biomarkers: GDF15, osteonectin, TRAP5, TWEAK, and YKL40 as being promising markers for monitoring bone metastases.
26938614 Cerebrospinal GDF15, but not MMP9, may be a potential marker of Lewy body disorders.
26867126 GDF-15 and FGF-21 are elevated in mitochondrial diseases
26745373 Transgenic mice expressing human non-steroidal anti-inflammatory drug activated gene 1 (NAG-1) have less adipose tissue, improved insulin sensitivity, lower insulin levels and are resistant to dietary induced obesity.
26520384 Results suggest that GDF-15 works as a radiation inducible radiation resistance increasing factor in normal human fibroblast cells by regulating the radiation-induced transcription of several genes and might serve as a radiation-induced early biomarker.
26511487 MIC1 may have a role in colorectal adenoma in women, especially multiple, large, and proximal adenomas
26497212 Data suggest that growth differentiation factor 15 (GDF15) may promote colorectal cancer metastasis through activating epithelial-mesenchymal transition (EMT), and could be considered as a prognostic clinical marker for colorectal cancer (CRC).
26463265 measurement of GDF-15 is the most useful first-line test to indicate the patients who have the mitochondrial respiratory chain deficiency
26365480 Our results suggest that the H6D genetic variant may be considered as a biomarker of tumorgenesis, metastasis and prognosis in colorectal cancer in Chinese population
26339382 Downregulation of growth differentiation factor-15 in trichostatin A-induced apoptosis could play a role in progression of gastric cancer.
More...

AA Sequence

MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRAN      1 - 70
QSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRP     71 - 140
LRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRC    141 - 210
CRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYN    211 - 280
PMVLIQKTDTGVSLQTYDDLLAKDCHCI                                              281 - 308
//

Text Mined References (242)

PMID Year Title
27069189 2016 Testing of a Novel Cancer Metastatic Multiplex Panel for the Detection of Bone-metastatic Disease - a Pilot Study.
26938614 2016 GDF15/MIC1 and MMP9 Cerebrospinal Fluid Levels in Parkinson's Disease and Lewy Body Dementia.
26867126 2016 GDF-15 Is Elevated in Children with Mitochondrial Diseases and Is Induced by Mitochondrial Dysfunction.
26745373 2016 Expression of Human NSAID Activated Gene 1 in Mice Leads to Altered Mammary Gland Differentiation and Impaired Lactation.
26520384 2015 Growth Differentiation Factor-15 (GDF-15) is a potential marker of radiation response and radiation sensitivity.
26511487 2016 Plasma Inflammatory Markers and Risk of Advanced Colorectal Adenoma in Women.
26497212 2016 GDF15 promotes EMT and metastasis in colorectal cancer.
26463265 2015 Growth differentiation factor 15 as a useful biomarker for mitochondrial disorders.
26365480 2015 The H6D genetic variation of GDF15 is associated with genesis, progress and prognosis in colorectal cancer.
26339382 2015 Downregulation of growth differentiation factor-15 in trichostatin A-induced apoptosis could play a role in progression of gastric cancer.
More...