Property Summary

NCBI Gene PubMed Count 287
PubMed Score 761.33
PubTator Score 615.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (26)

Disease log2 FC p
active ulcerative colitis 2.156 2.7e-02
adult high grade glioma 1.100 2.6e-02
atypical teratoid / rhabdoid tumor 2.900 1.2e-03
Breast cancer 1.700 1.1e-04
breast carcinoma 1.500 9.6e-03
colon cancer 1.400 1.3e-02
COPD 1.500 2.8e-02
ductal carcinoma in situ 2.400 2.3e-02
esophageal adenocarcinoma 2.700 2.0e-02
gastric carcinoma 2.200 2.1e-02
glioblastoma 1.700 1.0e-03
intraductal papillary-mucinous adenoma (... -2.400 5.5e-03
invasive ductal carcinoma 2.800 1.2e-02
juvenile dermatomyositis 1.026 4.2e-05
lung adenocarcinoma 1.800 2.4e-07
lung cancer 1.400 4.6e-04
nasopharyngeal carcinoma -1.400 6.7e-03
nephrosclerosis -1.841 9.8e-04
non-small cell lung carcinoma 1.200 6.4e-10
osteosarcoma 1.116 2.5e-02
ovarian cancer 1.100 4.4e-03
pancreatic ductal adenocarcinoma liver m... 1.019 4.2e-02
posterior fossa group A ependymoma 1.100 5.3e-03
psoriasis -1.200 5.1e-19
sarcoidosis -2.000 6.1e-03
subependymal giant cell astrocytoma 2.644 4.1e-02

Gene RIF (279)

AA Sequence

MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRAN      1 - 70
QSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRP     71 - 140
LRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRC    141 - 210
CRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYN    211 - 280
PMVLIQKTDTGVSLQTYDDLLAKDCHCI                                              281 - 308
//

Text Mined References (290)

PMID Year Title