Property Summary

NCBI Gene PubMed Count 239
Grant Count 55
R01 Count 14
Funding $7,375,198
PubMed Score 660.65
PubTator Score 615.01

Knowledge Summary

Patent

No data available

Expression

 IMPC Term (1)

Gene RIF (231)

PMID Text
27069189 We identified five new biomarkers: GDF15, osteonectin, TRAP5, TWEAK, and YKL40 as being promising markers for monitoring bone metastases.
26938614 Cerebrospinal GDF15, but not MMP9, may be a potential marker of Lewy body disorders.
26867126 GDF-15 and FGF-21 are elevated in mitochondrial diseases
26745373 Transgenic mice expressing human non-steroidal anti-inflammatory drug activated gene 1 (NAG-1) have less adipose tissue, improved insulin sensitivity, lower insulin levels and are resistant to dietary induced obesity.
26520384 Results suggest that GDF-15 works as a radiation inducible radiation resistance increasing factor in normal human fibroblast cells by regulating the radiation-induced transcription of several genes and might serve as a radiation-induced early biomarker.
26511487 MIC1 may have a role in colorectal adenoma in women, especially multiple, large, and proximal adenomas
26497212 Data suggest that growth differentiation factor 15 (GDF15) may promote colorectal cancer metastasis through activating epithelial-mesenchymal transition (EMT), and could be considered as a prognostic clinical marker for colorectal cancer (CRC).
26463265 measurement of GDF-15 is the most useful first-line test to indicate the patients who have the mitochondrial respiratory chain deficiency
26365480 Our results suggest that the H6D genetic variant may be considered as a biomarker of tumorgenesis, metastasis and prognosis in colorectal cancer in Chinese population
26339382 Downregulation of growth differentiation factor-15 in trichostatin A-induced apoptosis could play a role in progression of gastric cancer.
More...

AA Sequence

MPGQELRTVNGSQMLLVLLVLSWLPHGGALSLAEASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRAN      1 - 70
QSWEDSNTDLVPAPAVRILTPEVRLGSGGHLHLRISRAALPEGLPEASRLHRALFRLSPTASRSWDVTRP     71 - 140
LRRQLSLARPQAPALHLRLSPPPSQSDQLLAESSSARPQLELHLRPQAARGRRRARARNGDHCPLGPGRC    141 - 210
CRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYN    211 - 280
PMVLIQKTDTGVSLQTYDDLLAKDCHCI                                              281 - 308
//

Publication (242)

PMID Year Title
27069189 2016 Testing of a Novel Cancer Metastatic Multiplex Panel for the Detection of Bone-metastatic Disease - a Pilot Study.
26938614 2016 GDF15/MIC1 and MMP9 Cerebrospinal Fluid Levels in Parkinson's Disease and Lewy Body Dementia.
26867126 2016 GDF-15 Is Elevated in Children with Mitochondrial Diseases and Is Induced by Mitochondrial Dysfunction.
26745373 2016 Expression of Human NSAID Activated Gene 1 in Mice Leads to Altered Mammary Gland Differentiation and Impaired Lactation.
26520384 2015 Growth Differentiation Factor-15 (GDF-15) is a potential marker of radiation response and radiation sensitivity.
26511487 2016 Plasma Inflammatory Markers and Risk of Advanced Colorectal Adenoma in Women.
26497212 2016 GDF15 promotes EMT and metastasis in colorectal cancer.
26463265 2015 Growth differentiation factor 15 as a useful biomarker for mitochondrial disorders.
26365480 2015 The H6D genetic variation of GDF15 is associated with genesis, progress and prognosis in colorectal cancer.
26339382 2015 Downregulation of growth differentiation factor-15 in trichostatin A-induced apoptosis could play a role in progression of gastric cancer.
More...