Property Summary

NCBI Gene PubMed Count 49
Grant Count 8
Funding $951,751.22
PubMed Score 111.59
PubTator Score 69.12

Knowledge Summary

Patent (2,545)

Expression

Synonym

Accession Q99986 Q3SYL2
Symbols PCH1
PCH1A

Gene

PDB

2KTY   2KUL   2LAV   2RSV   3OP5  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (33)

PMID Text
26869104 VRK1 regulation of NBS1 contributes to the stability of the repair complex and permits the sequential steps in DNA damage response.
26375549 VRK1 may act as a tumor promoter by controlling the level of cell cycle regulators associated with G1/S transition and could potentially serve as a therapeutic target and/or prognostic biomarker for HCC.
26068304 VRK1 is a novel regulator of CBs dynamics and stability in cell cycle by protecting coilin from ubiquitination and degradation in the proteasome, and propose a model of CB dynamics.
25923214 VRK1 is a novel chromatin component that reacts to its alterations and participates very early in DNA damage response, functioning by itself or in cooperation with Ataxia Telangiectasia Mutated Proteins.
25609612 VRK1 deficiency in human and mouse leads to downregulation of amyloid-beta precursor protein (APP). APP overexpression rescues the phenotype caused by Vrk1 knockdown, suggesting that VRK1 affects neuronal migration through an APP-dependent mechanism.
24731990 VRK1 can contribute to make these tumors more resistant to DNA damage-based therapies, such as ionizing radiation or doxorubicin, which is consistent with its association to a poor prognosis in ER positive breast cancer.
24492002 The VRK1-p53 basal complex is an early-warning system for immediate cellular responses to DNA damage.
24430874 VRK1 deficiency disrupts nuclear envelope morphology and leads to BAF retention on mitotic chromosomes.
24126608 This study identification of disease-causing alleles in 3 children from 2 unrelated families with Mutations in VRK1 associated with complex motor and sensory axonal neuropathy plus microcephaly.
23223570 MKP2 is a negative regulator of VRK1-mediated histone H3 phosphorylation.
More...

AA Sequence

MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVV      1 - 70
KVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQK     71 - 140
IYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVH    141 - 210
KEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRE    211 - 280
NIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLK    281 - 350
AKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK                            351 - 396
//

Text Mined References (55)

PMID Year Title
26869104 2016 VRK1 phosphorylates and protects NBS1 from ubiquitination and proteasomal degradation in response to DNA damage.
26375549 2015 Vaccinia-related kinase 1 promotes hepatocellular carcinoma by controlling the levels of cell cycle regulators associated with G1/S transition.
26068304 2015 VRK1 regulates Cajal body dynamics and protects coilin from proteasomal degradation in cell cycle.
25923214 2015 VRK1 chromatin kinase phosphorylates H2AX and is required for foci formation induced by DNA damage.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25609612 2015 The spinal muscular atrophy with pontocerebellar hypoplasia gene VRK1 regulates neuronal migration through an amyloid-? precursor protein-dependent mechanism.
24847357 2014 Genome wide association study of SNP-, gene-, and pathway-based approaches to identify genes influencing susceptibility to Staphylococcus aureus infections.
24731990 2014 Vaccinia-related kinase 1 (VRK1) confers resistance to DNA-damaging agents in human breast cancer by affecting DNA damage response.
24684796 2014 Heritability and genetic association analysis of cognition in the Diabetes Heart Study.
24492002 2014 VRK1 interacts with p53 forming a basal complex that is activated by UV-induced DNA damage.
More...