Property Summary

NCBI Gene PubMed Count 52
PubMed Score 119.76
PubTator Score 69.12

Knowledge Summary

Patent (2,545)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Intellectual disability 1016 0.0 0.0
Pontocerebellar Hypoplasia Type 1 5 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Pontocerebellar hypoplasia 36 6.683 3.3
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0

Expression

  Differential Expression (11)

Disease log2 FC p
acute myeloid leukemia -1.100 4.7e-02
astrocytic glioma -1.700 9.1e-03
group 3 medulloblastoma 2.500 2.0e-05
intraductal papillary-mucinous carcinoma... 1.300 2.0e-03
intraductal papillary-mucinous neoplasm ... 1.800 1.9e-03
lung cancer 1.200 2.1e-03
medulloblastoma, large-cell 1.400 6.0e-05
Multiple myeloma 1.121 1.4e-02
oligodendroglioma -1.400 2.6e-02
pituitary cancer 1.100 1.9e-06
Waldenstrons macroglobulinemia 1.275 3.0e-02

Protein-protein Interaction (1)

Gene RIF (36)

AA Sequence

MPRVKAAQAGRQSSAKRHLAEQFAVGEIITDMAKKEWKVGLPIGQGGFGCIYLADMNSSESVGSDAPCVV      1 - 70
KVEPSDNGPLFTELKFYQRAAKPEQIQKWIRTRKLKYLGVPKYWGSGLHDKNGKSYRFMIMDRFGSDLQK     71 - 140
IYEANAKRFSRKTVLQLSLRILDILEYIHEHEYVHGDIKASNLLLNYKNPDQVYLVDYGLAYRYCPEGVH    141 - 210
KEYKEDPKRCHDGTIEFTSIDAHNGVAPSRRGDLEILGYCMIQWLTGHLPWEDNLKDPKYVRDSKIRYRE    211 - 280
NIASLMDKCFPEKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLKAIGSKDDGKLDLSVVENGGLK    281 - 350
AKTITKKRKKEIEESKEPGVEDTEWSNTQTEEAIQTRSRTRKRVQK                            351 - 396
//

Text Mined References (59)

PMID Year Title