Property Summary

NCBI Gene PubMed Count 12
PubMed Score 234.54
PubTator Score 7.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adrenocortical carcinoma -2.114 4.5e-11
astrocytic glioma -1.100 1.8e-02
Atopic dermatitis -2.800 1.1e-05
Breast cancer 2.300 3.7e-02
cutaneous lupus erythematosus -1.400 3.2e-02
ductal carcinoma in situ -1.600 4.0e-03
ependymoma -1.700 2.5e-03
interstitial cystitis -1.500 2.8e-02
intraductal papillary-mucinous adenoma (... -2.200 4.2e-03
intraductal papillary-mucinous carcinoma... -2.400 2.8e-03
intraductal papillary-mucinous neoplasm ... -2.300 2.8e-02
invasive ductal carcinoma -2.200 1.0e-03
lung carcinoma -2.100 1.6e-10
non diabetic and post-ischemic heart fai... 1.400 3.6e-02
oligodendroglioma -1.700 1.4e-03
ovarian cancer -2.700 3.0e-11
pituitary cancer -1.100 2.0e-03
psoriasis -1.300 1.1e-03
sonic hedgehog group medulloblastoma 1.400 5.6e-03

Protein-protein Interaction (4)

Gene RIF (4)

AA Sequence

MGFLSPIYVIFFFFGVKVHCQYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTLGCVSECFCPT      1 - 70
NFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKL     71 - 140
PNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLDLCYNYLHDSLLKDKIFAK    141 - 210
MEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLP    211 - 280
NIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYI    281 - 350
FFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQ    351 - 420
E//

Text Mined References (14)

PMID Year Title