Property Summary

NCBI Gene PubMed Count 12
PubMed Score 222.14
PubTator Score 7.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.95986217704747E-11
adrenocortical carcinoma 1427 4.48002460796389E-11
lung carcinoma 2844 1.59224405152728E-10
Atopic dermatitis 944 1.06099767142529E-5
invasive ductal carcinoma 2950 0.00136388096720542
oligodendroglioma 2849 0.00139233945195539
pituitary cancer 1972 0.00240638558222887
ependymoma 2514 0.00253719946013394
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00278025152964288
ductal carcinoma in situ 1745 0.0039774350493332
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00422256332557224
sonic hedgehog group medulloblastoma 1482 0.00563446481758109
astrocytic glioma 2241 0.0175736074931228
psoriasis 6685 0.0221273093274478
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.027680361648581
interstitial cystitis 2299 0.0279561128638397
cutaneous lupus erythematosus 1056 0.0318394510864632
non diabetic and post-ischemic heart failure 200 0.0360296714608781
Breast cancer 3099 0.0365574649866383

Expression

Synonym

Accession Q99983 Q5TBF4
Symbols OSAD
SLRR2C

Gene

OMD

PANTHER Protein Class (1)

  Ortholog (9)

Gene RIF (4)

PMID Text
26003732 Osteomodulin (OMD) directly binds to type 1 collagen. OMD suppresses formation of collagen fibrils.
25371314 Osteomodulin, osteoglycin, and asporin appear to be distinctly regulated in osteoarthritis labrum compared to OA cartilage.
19700767 tyrosine sulfate-rich domains of the LRR proteins fibromodulin and osteoadherin bind motifs of basic clusters in a variety of heparin-binding proteins, including bioactive factors
12489179 TGF beta 1 signaling and stimulation of osteoadherin in human pulpal fibroblasts and in early secretory and mature odontoblasts

AA Sequence

MGFLSPIYVIFFFFGVKVHCQYETYQWDEDYDQEPDDDYQTGFPFRQNVDYGVPFHQYTLGCVSECFCPT      1 - 70
NFPSSMYCDNRKLKTIPNIPMHIQQLYLQFNEIEAVTANSFINATHLKEINLSHNKIKSQKIDYGVFAKL     71 - 140
PNLLQLHLEHNNLEEFPFPLPKSLERLLLGYNEISKLQTNAMDGLVNLTMLDLCYNYLHDSLLKDKIFAK    141 - 210
MEKLMQLNLCSNRLESMPPGLPSSLMYLSLENNSISSIPEKYFDKLPKLHTLRMSHNKLQDIPYNIFNLP    211 - 280
NIVELSVGHNKLKQAFYIPRNLEHLYLQNNEIEKMNLTVMCPSIDPLHYHHLTYIRVDQNKLKEPISSYI    281 - 350
FFCFPHIHTIYYGEQRSTNGQTIQLKTQVFRRFPDDDDESEDHDDPDNAHESPEQEGAEGHFDLHYYENQ    351 - 420
E//

Text Mined References (14)

PMID Year Title
26003732 2015 Osteomodulin regulates diameter and alters shape of collagen fibrils.
25371314 2015 Distinct dysregulation of the small leucine-rich repeat protein family in osteoarthritic acetabular labrum compared to articular cartilage.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
19700767 2009 The tyrosine sulfate-rich domains of the LRR proteins fibromodulin and osteoadherin bind motifs of basic clusters in a variety of heparin-binding proteins, including bioactive factors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14673660 2004 Immunodetection of osteoadherin in murine tooth extracellular matrices.
14551184 2004 Identification of tyrosine sulfation in extracellular leucine-rich repeat proteins using mass spectrometry.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12489179 2002 TGF beta 1 signaling and stimulation of osteoadherin in human odontoblasts in vitro.
More...