Property Summary

NCBI Gene PubMed Count 33
Grant Count 30
R01 Count 14
Funding $4,704,946.83
PubMed Score 48.78
PubTator Score 116.16

Knowledge Summary


No data available


Gene RIF (20)

26238235 These data suggest that genetic variations in the TEP1 gene may be biomarkers for risk of PCa and BCR after RP.
24269974 8 common SNPs in telomerase reverse transcriptase (TERT) and telomerase-associated protein 1 (TEP1) were genotyped.
23739867 the protein levels of MVP, TEP1 and vPARP are actually increased in the highergrade tumors suggesting existence of post-transcriptional regulation of vault component production.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20937264 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19766477 Observational study of gene-disease association. (HuGE Navigator)
19692168 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

FRCEGSVSCLEPWLGANSTLQLAVGDVQGNVYFLNWE                                    2591 - 2627

Publication (36)

PMID Year Title
26238235 2015 Genetic variants in the TEP1 gene are associated with prostate cancer risk and recurrence.
24269974 2014 Genetic variants in telomerase reverse transcriptase (TERT) and telomerase-associated protein 1 (TEP1) and the risk of male infertility.
23739867 2013 Expression profiles of vault components MVP, TEP1 and vPARP and their correlation to other multidrug resistance proteins in ovarian cancer.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20937264 2011 Genetic variants in eleven telomere-associated genes and the risk of incident cardio/cerebrovascular disease: The Women's Genome Health Study.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19766477 2009 Polymorphisms in telomere-associated genes, breast cancer susceptibility and prognosis.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.