Property Summary

NCBI Gene PubMed Count 148
PubMed Score 314.13
PubTator Score 238.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma -1.855 1.9e-02
Astrocytoma, Pilocytic 1.900 5.4e-07
breast carcinoma -1.600 1.1e-03
colon cancer -1.100 2.1e-02
ductal carcinoma in situ -2.000 5.4e-04
fibroadenoma -2.400 2.1e-03
Gaucher disease type 3 -2.100 4.9e-02
head and neck cancer -1.100 7.1e-03
interstitial cystitis 1.600 2.2e-03
intraductal papillary-mucinous adenoma (... -3.800 9.4e-05
intraductal papillary-mucinous carcinoma... -4.300 2.4e-04
intraductal papillary-mucinous neoplasm ... -4.100 2.7e-03
invasive ductal carcinoma -2.500 1.9e-03
lung adenocarcinoma -2.400 6.7e-11
lung cancer -2.000 6.1e-04
lung carcinoma -1.900 1.8e-18
malignant mesothelioma 4.400 2.7e-09
non primary Sjogren syndrome sicca 1.400 1.8e-02
non-small cell lung cancer -1.156 4.7e-08
ovarian cancer -3.200 1.5e-06
pituitary cancer -2.100 5.0e-07
X-linked cerebral adrenoleukodystrophy 2.700 1.0e-03

 GO Function (1)

Protein-protein Interaction (4)

Gene RIF (136)

AA Sequence

MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF      1 - 70
KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQR     71 - 140
AGEDPHSFYFPGQFAFSKALPRS                                                   141 - 163
//

Text Mined References (151)

PMID Year Title