Property Summary

NCBI Gene PubMed Count 119
Grant Count 24
R01 Count 16
Funding $1,461,000.8
PubMed Score 278.60
PubTator Score 238.91

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (106)

PMID Text
26722546 The synovial fluid and synovial membrane levels of chemerin are increased in knee osteoarthritis patients
26721419 Suggest reduction of chemerin could contribute to the antiobesity/antidiabetic properties described for alpha-lipoic acid.
26471865 serum chemerin may have a role in acute ischemic stroke and carotid artery plaque instability in Chinese populations
26387454 Patients with PCOS showed increased serum chemerin concentrations as compared to healthy women
26277777 Together, these findings suggest that CCL2, RARRES2 and EFNB2 are host cell factors involved in respiratory syncytial virus replication.
26170530 Results show that patients with osteoporosis presented a higher level of serum chemerin, which witnessed an inverse correlation with bone marrow density.
26166341 there was no significant association between chemerin rs17173608 gene polymorphism and polycystic ovary syndrome after adjusting genotypes for body mass index and age.
26146067 plasma levels of chemerin and CRP are elevated in patients with acute coronary syndrome
26062410 Chemerin might induce insulin resistance in C2C12 cells through NF-kappaB pathway-mediated inflammatory reaction
26057200 chemerin is a novel biomarker of dilated cardiomyopathy
More...

AA Sequence

MRRLLIPLALWLGAVGVGVAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGIFVRLEF      1 - 70
KLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVLREAEEHQETQCLRVQR     71 - 140
AGEDPHSFYFPGQFAFSKALPRS                                                   141 - 163
//

Publication (122)

PMID Year Title
26722546 2015 Elevated chemerin levels in synovial fluid and synovial membrane from patients with knee osteoarthritis.
26721419 2016 Effects of alpha-lipoic acid on chemerin secretion in 3T3-L1 and human adipocytes.
26471865 2015 Association of Serum Chemerin Levels with Acute Ischemic Stroke and Carotid Artery Atherosclerosis in a Chinese Population.
26387454 2015 Increased serum chemerin concentrations in patients with polycystic ovary syndrome: Relationship between insulin resistance and ovarian volume.
26277777 2015 Identification of CCL2, RARRES2 and EFNB2 as host cell factors that influence the multistep replication of respiratory syncytial virus.
26170530 2015 Serum Chemerin Levels in relation to Osteoporosis and Bone Mineral Density: A Case-Control Study.
26166341 2015 Influence of chemerin rs17173608 polymorphism on polycystic ovary syndrome susceptibility.
26146067 2015 [The elevated levels of plasma chemerin and C-reactive protein in patients with acute coronary syndrome].
26062410 2015 [Chemerin induces insulin resistance in C2C12 cells through nuclear factor-?B pathway-mediated inflammatory reaction].
26057200 2015 Circulating chemerin levels elevated in dilated cardiomyopathy patients with overt heart failure.
More...