Property Summary

NCBI Gene PubMed Count 53
PubMed Score 126.69
PubTator Score 55.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
non-small cell lung cancer 2798 7.68464360343977E-18
lung carcinoma 2844 1.69477286654113E-13
ovarian cancer 8492 8.61813244145284E-8
lung cancer 4473 1.00687324147678E-7
juvenile dermatomyositis 1189 7.76079782157824E-6
Atopic dermatitis 944 8.46931318158473E-6
ulcerative colitis 2087 3.3636432150327E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 4.17754477069411E-4
nephrosclerosis 329 5.60133122619953E-4
fibroadenoma 557 5.67850723211053E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.32944538979193E-4
medulloblastoma, large-cell 6234 8.40322332039562E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00280555847371618
fascioscapulohumeral muscular dystrophy 100 0.00463843472927292
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00726247534756292
aldosterone-producing adenoma 664 0.0148310260538043
pilocytic astrocytoma 3086 0.0174398542589025
colon cancer 1475 0.0178489416314418
glioblastoma 5572 0.022353042461296
Barrett's esophagus 185 0.0238163621858543
esophageal adenocarcinoma 737 0.0325158241104495
group 4 medulloblastoma 1875 0.035444199589386
osteosarcoma 7933 0.0412805849928376
atypical teratoid/rhabdoid tumor 1095 0.0472360333268952
astrocytoma 1493 0.0488000664948757
Disease Target Count Z-score Confidence
Atrial heart septal defect 15 0.0 4.0
Disease Target Count Z-score Confidence
Congenital heart disease 63 4.524 2.3
spina bifida 1064 3.297 1.6

Expression

Synonym

Accession Q99967 O95426 Q5VTF4
Symbols ASD8
MRG1
VSD2
MRG-1
P35SRJ

Gene

PDB

1P4Q   1R8U  

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (28)

PMID Text
26851278 Intrinsic protein disorder plays a prominent role in the function and interactions of the transcriptional co-activators CBP and p300. (Review)
25956243 FBXL5-mediated degradation of CITED2 leads to the activation of HIF-1 alpha.
25184385 The increased CITED2 expression in acute myeloid leukemia results in better hematopoietic stem cell survival, lower PU.1 levels, and perturbed myeloid differentiation program that contributes to leukemia persistence.
24848765 CITED2 has a potential causative impact on congenital heart disease
24456003 Our study suggests that CITED2 gene mutations and methylation may play an important role in the development of pediatric congenital heart disease.
23811274 data indicate that CITED2 functions as a transcriptional co-activator of ER in breast cancer cells and that its increased expression in tumors may result in estrogen-independent ER activation
23212831 CITED2 is a direct effector of PPARgamma for tumor suppression.
23082118 CITED2 is phosphorylated by MAPK1 in vitro at T166, and that MAPK1 activation enhances the coactivation function of CITED2 but not of CITED2-T166N.
22814619 CITED2 functions as a molecular switch of TGF-alpha and TGF-beta-induced growth control, and MYC-CITED2 signaling axis provides a new index for predicting clinical outcome.
22735262 CITED2 variants decreased its ability to mediate the expression of vascular endothelial growth factor (VEGF) and the expression of the paired-like homeodomain transcription factor 2-gamma (PITX2C), both of which are closely related to cardiac development.
More...

AA Sequence

MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIR      1 - 70
HAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHP     71 - 140
AAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPA    141 - 210
AMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC              211 - 270
//

Text Mined References (56)

PMID Year Title
26851278 2016 Role of Intrinsic Protein Disorder in the Function and Interactions of the Transcriptional Coactivators CREB-binding Protein (CBP) and p300.
25956243 2015 FBXL5 modulates HIF-1? transcriptional activity by degradation of CITED2.
25184385 2015 CITED2-mediated human hematopoietic stem cell maintenance is critical for acute myeloid leukemia.
24848765 2014 Variations of CITED2 are associated with congenital heart disease (CHD) in Chinese population.
24456003 2014 CITED2 mutation and methylation in children with congenital heart disease.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23811274 2013 CITED2 modulates estrogen receptor transcriptional activity in breast cancer cells.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
More...