Property Summary

NCBI Gene PubMed Count 53
Grant Count 66
R01 Count 43
Funding $8,119,886.27
PubMed Score 126.69
PubTator Score 55.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q99967 O95426 Q5VTF4
Symbols ASD8
MRG1
VSD2
MRG-1
P35SRJ

Gene

PDB

1P4Q   1R8U  

Gene RIF (28)

PMID Text
26851278 Intrinsic protein disorder plays a prominent role in the function and interactions of the transcriptional co-activators CBP and p300. (Review)
25956243 FBXL5-mediated degradation of CITED2 leads to the activation of HIF-1 alpha.
25184385 The increased CITED2 expression in acute myeloid leukemia results in better hematopoietic stem cell survival, lower PU.1 levels, and perturbed myeloid differentiation program that contributes to leukemia persistence.
24848765 CITED2 has a potential causative impact on congenital heart disease
24456003 Our study suggests that CITED2 gene mutations and methylation may play an important role in the development of pediatric congenital heart disease.
23811274 data indicate that CITED2 functions as a transcriptional co-activator of ER in breast cancer cells and that its increased expression in tumors may result in estrogen-independent ER activation
23212831 CITED2 is a direct effector of PPARgamma for tumor suppression.
23082118 CITED2 is phosphorylated by MAPK1 in vitro at T166, and that MAPK1 activation enhances the coactivation function of CITED2 but not of CITED2-T166N.
22814619 CITED2 functions as a molecular switch of TGF-alpha and TGF-beta-induced growth control, and MYC-CITED2 signaling axis provides a new index for predicting clinical outcome.
22735262 CITED2 variants decreased its ability to mediate the expression of vascular endothelial growth factor (VEGF) and the expression of the paired-like homeodomain transcription factor 2-gamma (PITX2C), both of which are closely related to cardiac development.
More...

AA Sequence

MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIR      1 - 70
HAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHP     71 - 140
AAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPA    141 - 210
AMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC              211 - 270
//

Text Mined References (56)

PMID Year Title
26851278 2016 Role of Intrinsic Protein Disorder in the Function and Interactions of the Transcriptional Coactivators CREB-binding Protein (CBP) and p300.
25956243 2015 FBXL5 modulates HIF-1? transcriptional activity by degradation of CITED2.
25184385 2015 CITED2-mediated human hematopoietic stem cell maintenance is critical for acute myeloid leukemia.
24848765 2014 Variations of CITED2 are associated with congenital heart disease (CHD) in Chinese population.
24456003 2014 CITED2 mutation and methylation in children with congenital heart disease.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23811274 2013 CITED2 modulates estrogen receptor transcriptional activity in breast cancer cells.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23263863 2013 GWAS of blood cell traits identifies novel associated loci and epistatic interactions in Caucasian and African-American children.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
More...