Property Summary

NCBI Gene PubMed Count 62
PubMed Score 134.77
PubTator Score 55.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Right atrial isomerism 29 0.0 5.0
Disease Target Count Z-score Confidence
Atrial heart septal defect 18 0.0 4.0
Disease Target Count Z-score Confidence
Congenital heart disease 93 4.629 2.3
Cancer 2499 3.013 1.5

Expression

  Differential Expression (26)

Disease log2 FC p
spina bifida -2.260 3.1e-02
aldosterone-producing adenoma -1.957 1.5e-02
astrocytoma 1.100 4.9e-02
Astrocytoma, Pilocytic -1.200 1.7e-02
Atopic dermatitis -2.700 8.5e-06
atypical teratoid/rhabdoid tumor 1.400 4.7e-02
autosomal dominant Emery-Dreifuss muscul... 1.463 1.8e-02
Barrett's esophagus -1.500 2.4e-02
colon cancer -1.500 1.6e-03
esophageal adenocarcinoma -2.200 3.3e-02
fascioscapulohumeral muscular dystrophy 1.186 4.6e-03
fibroadenoma -1.200 5.7e-04
glioblastoma -1.200 2.2e-02
group 4 medulloblastoma 1.800 3.5e-02
intraductal papillary-mucinous adenoma (... -1.500 7.3e-04
intraductal papillary-mucinous carcinoma... -1.700 4.2e-04
intraductal papillary-mucinous neoplasm ... -1.700 2.8e-03
juvenile dermatomyositis 1.285 7.8e-06
lung cancer -2.900 2.1e-05
lung carcinoma -1.200 1.7e-13
medulloblastoma, large-cell -1.500 1.1e-02
nephrosclerosis 1.013 5.6e-04
non-small cell lung cancer -1.565 1.8e-14
osteosarcoma -1.407 4.1e-02
ovarian cancer -2.100 8.6e-08
ulcerative colitis -1.115 1.0e-02

Protein-protein Interaction (2)

Gene RIF (36)

AA Sequence

MADHMMAMNHGRFPDGTNGLHHHPAHRMGMGQFPSPHHHQQQQPQHAFNALMGEHIHYGAGNMNATSGIR      1 - 70
HAMGPGTVNGGHPPSALAPAARFNNSQFMGPPVASQGGSLPASMQLQKLNNQYFNHHPYPHNHYMPDLHP     71 - 140
AAGHQMNGTNQHFRDCNPKHSGGSSTPGGSGGSSTPGGSGSSSGGGAGSSNSGGGSGSGNMPASVAHVPA    141 - 210
AMLPPNVIDTDFIDEEVLMSLVIEMGLDRIKELPELWLGQNEFDFMTDFVCKQQPSRVSC              211 - 270
//

Text Mined References (64)

PMID Year Title