Property Summary

NCBI Gene PubMed Count 25
Grant Count 35
R01 Count 14
Funding $4,875,974.51
PubMed Score 54.21
PubTator Score 36.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
posterior fossa group B ependymoma -1.800 0.000
glioblastoma 2.200 0.004
group 3 medulloblastoma 1.700 0.000
pilocytic astrocytoma 1.200 0.001
Breast cancer -3.400 0.000
breast carcinoma -1.100 0.000

Gene RIF (8)

PMID Text
24481423 Forced nuclear enrichment of CITED1 in a human WT cell line appears to enhance tumorigenicity, whereas ectopic cytosolic expression confers stem-like properties and an embryonic phenotype.
23935526 Thus deficiency of Cited1 leads to hyper-activation of Wnt signaling and an exaggerated Wnt phenotype including elevated cell death
23746764 The CITED1 expression is correlated with lymph node metastasis in patients with colorectal cancer.
22703800 CITED1 expression remains active across all disease characteristics of Wilms tumor. It is found in the nucleus & cytosol. It is not found in normal kidney.
21449767 epigenetic regulation is involved in the overexpression of CITED1 in papillary thyroid cancer
21172805 TOX3 induces transcription in neuron depending on the presence of CITED1 or phosphorylated CREB in the transcriptionally active complex.
17710162 CITED1 could play a role in Wilms' tumor initiation and pathogenesis.
16864582 CITED1 functions as a cell cycle-dependent transcriptional cofactor whose activity is regulated by phosphorylation

AA Sequence

MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIG      1 - 70
SPTTTPPTKPPSFNLHPAPHLLASMHLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSA     71 - 140
GAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC                     141 - 193
//

Publication (30)

PMID Year Title
24481423 2014 CITED1 confers stemness to Wilms tumor and enhances tumorigenic responses when enriched in the nucleus.
23935526 2013 Cited1 deficiency suppresses intestinal tumorigenesis.
23746764 2013 Predicting lymph node metastasis in early colorectal cancer using the CITED1 expression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22703800 2012 SIX2 and CITED1, markers of nephronic progenitor self-renewal, remain active in primitive elements of Wilms' tumor.
21449767 2011 Aberrant promoter methylation in overexpression of CITED1 in papillary thyroid cancer.
21172805 2011 TOX3 is a neuronal survival factor that induces transcription depending on the presence of CITED1 or phosphorylated CREB in the transcriptionally active complex.
19054851 2008 Human protein factory for converting the transcriptome into an in vitro-expressed proteome,.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17938205 2007 An EGR2/CITED1 transcription factor complex and the 14-3-3sigma tumor suppressor are involved in regulating ErbB2 expression in a transgenic-mouse model of human breast cancer.
More...