Property Summary

NCBI Gene PubMed Count 25
PubMed Score 57.51
PubTator Score 36.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
Breast cancer 3578 1.0e-24
breast carcinoma 1638 2.9e-08
ependymoma 4679 8.4e-06
group 3 medulloblastoma 4104 1.4e-04
Astrocytoma, Pilocytic 3081 1.9e-04
glioblastoma 5792 4.5e-03
Disease Target Count Z-score Confidence
Follicular adenoma 7 3.232 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
Astrocytoma, Pilocytic 1.400 1.9e-04
Breast cancer -3.400 1.0e-24
breast carcinoma -1.100 2.9e-08
ependymoma -1.400 8.4e-06
glioblastoma 2.200 4.5e-03
group 3 medulloblastoma 1.700 1.4e-04

Gene RIF (8)

AA Sequence

MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIG      1 - 70
SPTTTPPTKPPSFNLHPAPHLLASMHLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSA     71 - 140
GAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC                     141 - 193
//

Text Mined References (30)

PMID Year Title