Property Summary

NCBI Gene PubMed Count 14
Grant Count 27
R01 Count 21
Funding $3,516,420.43
PubMed Score 144.14
PubTator Score 42.90

Knowledge Summary


No data available

Gene RIF (2)

26252478 ADAM2, CALR3 and SAGE1 cancer/testis antigens are not promising targets for immunotherapy of breast and lung cancer.
18292840 The fertilin beta contributes not only to successful fertilization, but may has an important impact in development of preimplantation embryos.

AA Sequence

VLIAIMVKVNFQRKKWRTEDYSSDEQPESESEPKG                                       701 - 735

Publication (14)

PMID Year Title
26252478 2015 Lack of ADAM2, CALR3 and SAGE1 Cancer/Testis Antigen Expression in Lung and Breast Cancer.
22926424 2012 Testicular and epididymal ADAMs: expression and function during fertilization.
19951893 2009 Evolutionary divergence and functions of the ADAM and ADAMTS gene families.
18292840 2007 Association between fertilin beta, protamines 1 and 2 and spermatid-specific linker histone H1-like protein mRNA levels, fertilization ability of human spermatozoa, and quality of preimplantation embryos.
17023585 2007 Cancer-testis antigens are commonly expressed in multiple myeloma and induce systemic immunity following allogeneic stem cell transplantation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11882657 2002 Functional classification of ADAMs based on a conserved motif for binding to integrin alpha 9beta 1: implications for sperm-egg binding and other cell interactions.
11784061 2001 Calmegin is required for fertilin alpha/beta heterodimerization and sperm fertility.
10518536 1999 Role of the integrin-associated protein CD9 in binding between sperm ADAM 2 and the egg integrin alpha6beta1: implications for murine fertilization.