Property Summary

NCBI Gene PubMed Count 75
PubMed Score 59.87
PubTator Score 24.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -3.100 1.1e-04
astrocytic glioma -1.300 9.3e-03
Astrocytoma, Pilocytic -3.200 3.9e-10
atypical teratoid / rhabdoid tumor -5.900 2.0e-11
ependymoma -3.200 3.6e-02
gastric carcinoma -3.600 9.5e-03
glioblastoma -3.800 7.5e-08
group 3 medulloblastoma -2.500 1.4e-02
interstitial cystitis -3.500 4.8e-04
lung carcinoma 1.600 1.7e-14
medulloblastoma, large-cell -3.800 1.8e-07
nephrosclerosis -1.505 4.2e-03
oligodendroglioma -1.400 3.7e-02
ovarian cancer -2.100 1.5e-06
Pick disease -1.800 1.5e-02
primitive neuroectodermal tumor -3.500 9.2e-05
psoriasis -1.200 1.1e-10
subependymal giant cell astrocytoma -3.326 2.8e-03
urothelial carcinoma -4.400 1.0e-04

Protein-protein Interaction (4)

Gene RIF (21)

AA Sequence

MSVAGLKKQFHKATQKVSEKVGGAEGTKLDDDFKEMERKVDVTSRAVMEIMTKTIEYLQPNPASRAKLSM      1 - 70
INTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMRELSEVKDSLDIEVKQNFI     71 - 140
DPLQNLHDKDLREIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIE    141 - 210
QVSQLSALVQAQLEYHKQAVQILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHT    211 - 280
GTPKPSGVQMDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGHSGFFPINYVEILVAL    281 - 350
PH                                                                        351 - 352
//

Text Mined References (79)

PMID Year Title