Property Summary

NCBI Gene PubMed Count 33
PubMed Score 134.18
PubTator Score 16.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count
Leukemia, Myelocytic, Acute 120
Disease Target Count P-value
esophageal adenocarcinoma 737 2.0e-02
non primary Sjogren syndrome sicca 891 2.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 0.0 4.0
Disease Target Count Z-score Confidence
Diaphragmatic eventration 11 3.562 1.8
Disease Target Count
Leukemia, Acute Myeloid 17

Expression

  Differential Expression (2)

Disease log2 FC p
esophageal adenocarcinoma -1.100 2.0e-02
non primary Sjogren syndrome sicca 1.100 2.1e-02

 GWAS Trait (1)

Gene RIF (15)

AA Sequence

MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTM      1 - 70
LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFI     71 - 140
DPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIE    141 - 210
QVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTA    211 - 280
PKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDG    281 - 350
QSGFFPLSYVEVLVPLPQ                                                        351 - 368
//

Text Mined References (44)

PMID Year Title