Property Summary

NCBI Gene PubMed Count 31
Grant Count 43
R01 Count 20
Funding $3,062,690.05
PubMed Score 115.62
PubTator Score 16.66

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
esophageal adenocarcinoma -1.100 0.020
non primary Sjogren syndrome sicca 1.100 0.021

Gene RIF (13)

PMID Text
25784716 Endo II expression was highest in triple-negative breast cancers tumors compared with other subtypes, and at the level of gene expression, high Endo II was associated with reduced relapse-free survival in patients with basal-like breast cancers.
25517096 results establish a novel function of endoA2 in clathrin-independent endocytosis
24704450 these data suggest that EEN may play a pivotal role in excessive cell proliferation and insufficient cell apoptosis of bone marrow plasma cells in multiple myeloma.
23970061 MIR218 functions as a tumor suppressor by regulating SH3GL1 expression in medulloblastoma cancer cells.
23050879 SH3GL1 may be involved in the oncogenic process of gliomas and effectively elicit an autologous antibody response in low-grade gliomas.
22750032 Two endophilin A2 mutants, E264A and E264R, have different effects on how endophilin interacts with other proteins, such as dynamin or beta1-adrenergic receptors.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22183150 Idiopathic scoliosis is a multifactorial genetic disease and SH3GL1 may be one of the pathogenic genes for this disease.
20627007 SH3GL1 is possibly one of the disease associated genes of adolescent idiopathic scoliosis.
15944398 findings reveal a concomitant activation of endocytosis and ERK signaling by BPGAP1 via the coupling of its proline-rich region, which targets EEN and its functional GAP domain
More...

AA Sequence

MSVAGLKKQFYKASQLVSEKVGGAEGTKLDDDFKEMEKKVDVTSKAVTEVLARTIEYLQPNPASRAKLTM      1 - 70
LNTVSKIRGQVKNPGYPQSEGLLGECMIRHGKELGGESNFGDALLDAGESMKRLAEVKDSLDIEVKQNFI     71 - 140
DPLQNLCEKDLKEIQHHLKKLEGRRLDFDYKKKRQGKIPDEELRQALEKFEESKEVAETSMHNLLETDIE    141 - 210
QVSQLSALVDAQLDYHRQAVQILDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTA    211 - 280
PKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKALYDFEPENDGELGFHEGDVITLTNQIDENWYEGMLDG    281 - 350
QSGFFPLSYVEVLVPLPQ                                                        351 - 368
//

Publication (42)

PMID Year Title
25784716 2015 Endophilin A2 Promotes TNBC Cell Invasion and Tumor Metastasis.
25517096 2015 Endophilin-A2 functions in membrane scission in clathrin-independent endocytosis.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24704450 2014 EEN regulates the proliferation and survival of multiple myeloma cells by potentiating IGF-1 secretion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23970061 2013 miR-218 is downregulated and directly targets SH3GL1 in childhood medulloblastoma.
23285027 2012 Bin2 is a membrane sculpting N-BAR protein that influences leucocyte podosomes, motility and phagocytosis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23050879 2012 Autologous antibody to src-homology 3-domain GRB2-like 1 specifically increases in the sera of patients with low-grade gliomas.
22750032 2012 Characterization of two distinct modes of endophilin in clathrin-mediated endocytosis.
More...