Property Summary

NCBI Gene PubMed Count 78
Grant Count 18
R01 Count 11
Funding $3,369,772.34
PubMed Score 125.51
PubTator Score 137.60

Knowledge Summary


No data available


Gene RIF (61)

26995964 PKP2 regulates Wnt activity during adipogenic and cardiomyogenic differentiation in arrhythmogenic right ventricular cardiomyopathy.
26321091 Family members - desmosomal mutation carriers who restricted exercise at or below the upper bound of the American Heart Association goal were less likely to be diagnosed and had no Ventricular Tachycardia.
26260507 A heterozygous pathogenic variant in the plakophilin-2 (c.2392A>G, p.T798A) gene was found in an arrhythmogenic LV cardiomyopathy patient and his deceased mother who had had arrhythmogenic cardiomyopathy affecting both ventricles.
25972099 Data suggest juxtamembrane regions/domains of desmocollin-2 (DSC2), plakophilin 2 (PKP2), and plakophilin 3 (PKP3) are involved in desmosome formation in epithelial cells; DSC2 participates in desmosome formation in absence of desmoglein 2 (DSG2).
25936878 Exercise test is valuable for the diagnosis of ARVC in patients with PKP2 gene mutation.
25900994 Case Report: PKP2/DSP mutations in patient with Brugada syndrome and ventricular tachycardia.
25889434 Plakofilin2 mutation plays an important role in the pathogenesis of Brugada syndrome.
25857910 The introduction of the PKP2 R735X mutation into mice resulted in an exercise-dependent arrhythmogenic right ventricular cardiomyopathy.
25786693 Extreme variability in clinical penetrance for a splice-site PKP2 mutation was found in a Bangladeshi family. Some family members were affected by arrhythmogenic right ventricular cardiomyopathy, and some are asymptomatic.
25398255 Currently, 13 genes have been associated with the disease but nearly 40 % of clinically diagnosed cases remain without a genetic diagnosis.

AA Sequence

SVLLYSLWAHTELHHAYKKAQFKKTDFVNSRTAKAYHSLKD                                 841 - 881

Text Mined References (89)

PMID Year Title
26321091 2016 Safety of American Heart Association-recommended minimum exercise for desmosomal mutation carriers.
26260507 2015 Arrhythmogenic Left Ventricular Cardiomyopathy: Suspected by Cardiac Magnetic Resonance Imaging, Confirmed by Identification of a Novel Plakophilin-2 Variant.
25972099 2015 Desmocollin-2 alone forms functional desmosomal plaques, with the plaque formation requiring the juxtamembrane region and plakophilins.
25936878 2015 Epsilon wave uncovered by exercise test in a patient with desmoplakin-positive arrhythmogenic right ventricular cardiomyopathy.
25900994 2015 Epicardial Ventricular Tachycardia Ablation in a Patient With Brugada ECG Pattern and Mutation of PKP2 and DSP Genes.
25889434 2015 Is Brugada syndrome a variant of arrhythmogenic cardiomyopathy?
25857910 2015 Exercise triggers ARVC phenotype in mice expressing a disease-causing mutated version of human plakophilin-2.
25786693 2015 Extreme variability in clinical penetrance for a splice-site Plakophilin-2 mutation in a Bangladeshi family.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.