Property Summary

NCBI Gene PubMed Count 87
PubMed Score 135.32
PubTator Score 137.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Arrhythmogenic Right Ventricular Dysplasia, Familial, 9 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Arrhythmogenic right ventricular cardiomyopathy 30 7.934 4.0
Disease Target Count Z-score Confidence
Cardiomyopathy 116 0.0 4.0
Disease Target Count Z-score Confidence
Brugada syndrome 29 4.3 2.1
Dilated cardiomyopathy 56 3.581 1.8

Expression

  Differential Expression (20)

Disease log2 FC p
acute myeloid leukemia -1.300 2.4e-03
atypical teratoid/rhabdoid tumor 1.300 2.4e-02
Barrett's esophagus 1.500 3.7e-02
Breast cancer -1.300 2.3e-04
cystic fibrosis -3.074 8.0e-07
glioblastoma -1.300 3.7e-04
interstitial cystitis -1.700 1.9e-02
intraductal papillary-mucinous adenoma (... 1.500 8.4e-03
intraductal papillary-mucinous carcinoma... 1.800 1.3e-02
intraductal papillary-mucinous neoplasm ... 2.000 1.1e-02
lung cancer 1.200 1.1e-02
lung carcinoma 1.700 3.0e-09
osteosarcoma -2.624 9.8e-04
ovarian cancer -1.500 4.7e-03
pediatric high grade glioma -1.100 2.8e-04
pituitary cancer -2.000 2.6e-03
posterior fossa group A ependymoma 1.200 6.7e-04
primitive neuroectodermal tumor -1.200 2.5e-02
psoriasis -1.300 7.7e-04
urothelial carcinoma -1.400 4.4e-02

Gene RIF (67)

AA Sequence

MAAPGAPAEYGYIRTVLGQQILGQLDSSSLALPSEAKLKLAGSSGRGGQTVKSLRIQEQVQQTLARKGRS      1 - 70
SVGNGNLHRTSSVPEYVYNLHLVENDFVGGRSPVPKTYDMLKAGTTATYEGRWGRGTAQYSSQKSVEERS     71 - 140
LRHPLRRLEISPDSSPERAHYTHSDYQYSQRSQAGHTLHHQESRRAALLVPPRYARSEIVGVSRAGTTSR    141 - 210
QRHFDTYHRQYQHGSVSDTVFDSIPANPALLTYPRPGTSRSMGNLLEKENYLTAGLTVGQVRPLVPLQPV    211 - 280
TQNRASRSSWHQSSFHSTRTLREAGPSVAVDSSGRRAHLTVGQAAAGGSGNLLTERSTFTDSQLGNADME    281 - 350
MTLERAVSMLEADHMLPSRISAAATFIQHECFQKSEARKRVNQLRGILKLLQLLKVQNEDVQRAVCGALR    351 - 420
NLVFEDNDNKLEVAELNGVPRLLQVLKQTRDLETKKQITDHTVNLRSRNGWPGAVAHACNPSTLGGQGGR    421 - 490
ITRSGVRDQPDQHGLLWNLSSNDKLKNLMITEALLTLTENIIIPFSGWPEGDYPKANGLLDFDIFYNVTG    491 - 560
CLRNMSSAGADGRKAMRRCDGLIDSLVHYVRGTIADYQPDDKATENCVCILHNLSYQLEAELPEKYSQNI    561 - 630
YIQNRNIQTDNNKSIGCFGSRSRKVKEQYQDVPMPEEKSNPKGVEWLWHSIVIRMYLSLIAKSVRNYTQE    631 - 700
ASLGALQNLTAGSGPMPTSVAQTVVQKESGLQHTRKMLHVGDPSVKKTAISLLRNLSRNLSLQNEIAKET    701 - 770
LPDLVSIIPDTVPSTDLLIETTASACYTLNNIIQNSYQNARDLLNTGGIQKIMAISAGDAYASNKASKAA    771 - 840
SVLLYSLWAHTELHHAYKKAQFKKTDFVNSRTAKAYHSLKD                                 841 - 881
//

Text Mined References (97)

PMID Year Title