Property Summary

NCBI Gene PubMed Count 117
PubMed Score 186.99
PubTator Score 143.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count P-value
cystic fibrosis 1696 2.0e-05
ovarian cancer 8520 1.5e-04
osteosarcoma 7950 5.5e-03
ependymoma 4679 9.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (4)

Disease log2 FC p
cystic fibrosis -1.325 2.0e-05
ependymoma -1.100 9.6e-03
osteosarcoma 1.066 5.5e-03
ovarian cancer -1.100 1.5e-04

 GWAS Trait (1)

Gene RIF (104)

AA Sequence

MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYSAGMGRSYAPYHHHQPAAPKDL      1 - 70
VKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKP     71 - 140
GKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKK    141 - 210
VVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRT    211 - 280
SPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCV    281 - 350
PPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQ    351 - 420
AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRH    421 - 490
AAPYSYDCTKY                                                               491 - 501
//

Text Mined References (125)

PMID Year Title