Property Summary

NCBI Gene PubMed Count 105
Grant Count 55
R01 Count 42
Funding $8,025,854.28
PubMed Score 174.19
PubTator Score 143.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
ependymoma -1.100 0.010
osteosarcoma 2.017 0.005
cystic fibrosis -1.489 0.000
ovarian cancer -1.100 0.000

 GO Component (1)

Gene RIF (92)

PMID Text
27349002 FOXC2 gene is associated with the glycolipid metabolic abnormality in T2DM patients.
26824865 Adenovirus-mediated FoxC2 expression enhances BMP7-facilitated anabolism in nucleus pulposus cells of the intervertebral discs.
26808710 Data indicate the role for altered forkhead box C2 (FoxC2)-Delta-like ligand 4 (Dll4)signaling in structural alterations of saphenous veins in patients with varicose veins.
26758745 Evaluation of FoxC2 expression, alone or in combination with E-cadherin expression, may help to stratify non-small cell lung cancer patients for risk of disease progression, pointing to this EMT regulator as a potential prognostic marker
26524507 The data indicate that the expression of FOXC2 in podocytes needs to be tightly regulated, and that its overexpression induces a chain of cellular events leading to podocyte dysfunction.
26389677 In cultured lymphatic endothelial cells, FOXC2 inactivation conferred abnormal shear stress sensing, promoting junction disassembly and entry into the cell cycle. This was mediated by TAZ and led to cell death.
26125751 Peri-tumoral lymphatics were associated with increased lymphatic metastasis. FOXC2 may be associated with the genesis of endometrial carcinoma and lymphangiogensis in endometrial adenocarcinoma in intra- and peri-tumoral lymphatics.
26091406 our findings contribute to the putative targets in which the FLT4 gene mutation was found to have a significant role in lymphatic filariasis, while FOXC2 and FLT4 SNP interactions need to be further elucidated at a functional level.
25896630 targeting FOXC2 may provide a novel strategy for overcoming chemoresistance in nasopharyngeal carcinoma therapy.
25677742 Twist and Foxc2 stromal expression in PTs was significantly correlated with tumour grade and worse histological features.
More...

AA Sequence

MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYSAGMGRSYAPYHHHQPAAPKDL      1 - 70
VKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKP     71 - 140
GKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKK    141 - 210
VVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRT    211 - 280
SPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCV    281 - 350
PPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQ    351 - 420
AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRH    421 - 490
AAPYSYDCTKY                                                               491 - 501
//

Text Mined References (112)

PMID Year Title
27349002 2016 Correlations of FOXC2 Gene Expression and Polymorphism with Type 2 Diabetes Mellitus.
26824865 2016 FoxC2 Enhances BMP7-Mediated Anabolism in Nucleus Pulposus Cells of the Intervertebral Disc.
26808710 2016 Arterialization and anomalous vein wall remodeling in varicose veins is associated with upregulated FoxC2-Dll4 pathway.
26758745 2016 Prognostic value of high FoxC2 expression in resectable non-small cell lung cancer, alone or in combination with E-cadherin expression.
26524507 2016 Overexpression of transcription factor FOXC2 in cultured human podocytes upregulates injury markers and increases motility.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26389677 2015 FOXC2 and fluid shear stress stabilize postnatal lymphatic vasculature.
26125751 2015 Effects of forkhead box C2 on carcinogenesis and lymphatic metastasis in endometrial carcinoma.
26091406 2015 FOXC2 and FLT4 Gene Variants in Lymphatic Filariasis.
25896630 2015 FOXC2 promotes chemoresistance in nasopharyngeal carcinomas via induction of epithelial mesenchymal transition.
More...