Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.46
PubTator Score 8.65

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
tuberculosis 2010 3.3e-07
psoriasis 6694 6.4e-05
breast carcinoma 1638 1.5e-03
osteosarcoma 7950 7.1e-03
non primary Sjogren syndrome sicca 891 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Pyoderma gangrenosum 9 3.119 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
breast carcinoma 1.200 1.5e-03
non primary Sjogren syndrome sicca 1.300 2.7e-02
osteosarcoma -1.036 7.1e-03
psoriasis -1.600 6.4e-05
tuberculosis 1.200 3.3e-07

Gene RIF (3)

AA Sequence

MSRSLDSARSFLERLEARGGREGAVLAGEFSDIQACSAAWKADGVCSTVAGSRPENVRKNRYKDVLPYDQ      1 - 70
TRVILSLLQEEGHSDYINGNFIRGVDGSLAYIATQGPLPHTLLDFWRLVWEFGVKVILMACREIENGRKR     71 - 140
CERYWAQEQEPLQTGLFCITLIKEKWLNEDIMLRTLKVTFQKESRSVYQLQYMSWPDRGVPSSPDHMLAM    141 - 210
VEEARRLQGSGPEPLCVHCSAGCGRTGVLCTVDYVRQLLLTQMIPPDFSLFDVVLKMRKQRPAAVQTEEQ    211 - 280
YRFLYHTVAQMFCSTLQNASPHYQNIKENCAPLYDDALFLRTPQALLAIPRPPGGVLRSISVPGSPGHAM    281 - 350
ADTYAVVQKRGAPAGAGSGTQTGTGTGTGARSAEEAPLYSKVTPRAQRPGAHAEDARGTLPGRVPADQSP    351 - 420
AGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV                                  421 - 460
//

Text Mined References (21)

PMID Year Title