Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.46
PubTator Score 8.65

Knowledge Summary


No data available


  Differential Expression (5)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -1.272 0.001
tuberculosis 1.500 0.000
breast carcinoma 1.200 0.001
non primary Sjogren syndrome sicca 1.300 0.027

Gene RIF (3)

25081058 PTPN18 regulates HER2-mediated cellular functions through defining both its phosphorylation and ubiquitination barcodes.
16303740 novel isoform of PTPN18 based on analysis of expressed sequence tags was discovered; deletion of 4 exons in the catalytic domain of the isoform may alter enzymatic activity; 2 of the novel isoform predictions were experimentally validated through RT-PCR
14660651 BDP1 has a role in negative regulation of HER2 signaling

AA Sequence

AGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV                                  421 - 460

Text Mined References (21)

PMID Year Title
25081058 2014 The catalytic region and PEST domain of PTPN18 distinctly regulate the HER2 phosphorylation and ubiquitination barcodes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303740 2005 A bioinformatics analysis of protein tyrosine phosphatases in humans.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.