Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.46
PubTator Score 8.65

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
tuberculosis 1563 5.49162220994841E-7
psoriasis 6685 6.39442034498403E-5
osteosarcoma 7933 5.95880233141455E-4
breast carcinoma 1614 0.00145988897594518
non primary Sjogren syndrome sicca 840 0.027488160706716
Disease Target Count Z-score Confidence
Pyoderma gangrenosum 9 3.11 1.6


  Differential Expression (5)

Disease log2 FC p
psoriasis -1.600 0.000
osteosarcoma -1.272 0.001
tuberculosis 1.500 0.000
breast carcinoma 1.200 0.001
non primary Sjogren syndrome sicca 1.300 0.027


Accession Q99952 B4E1E6 Q53P42
Symbols BDP1



4GFU   2OC3   4GFV   4NND  

  Ortholog (9)

Gene RIF (3)

25081058 PTPN18 regulates HER2-mediated cellular functions through defining both its phosphorylation and ubiquitination barcodes.
16303740 novel isoform of PTPN18 based on analysis of expressed sequence tags was discovered; deletion of 4 exons in the catalytic domain of the isoform may alter enzymatic activity; 2 of the novel isoform predictions were experimentally validated through RT-PCR
14660651 BDP1 has a role in negative regulation of HER2 signaling

AA Sequence

AGSGAYEDVAGGAQTGGLGFNLRIGRPKGPRDPPAEWTRV                                  421 - 460

Text Mined References (21)

PMID Year Title
25081058 2014 The catalytic region and PEST domain of PTPN18 distinctly regulate the HER2 phosphorylation and ubiquitination barcodes.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19167335 2009 Large-scale structural analysis of the classical human protein tyrosine phosphatome.
16341674 2005 Transcriptome analysis of human gastric cancer.
16303740 2005 A bioinformatics analysis of protein tyrosine phosphatases in humans.
16094384 2005 Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.