Property Summary

NCBI Gene PubMed Count 10
Grant Count 1
Funding $54,195.75
PubMed Score 16.56
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
posterior fossa group A ependymoma -2.800 0.000
astrocytoma -1.700 0.000
glioblastoma -3.100 0.000
oligodendroglioma -1.700 0.000
osteosarcoma -1.354 0.007
group 3 medulloblastoma -3.400 0.000
atypical teratoid/rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -2.400 0.000
primitive neuroectodermal tumor -2.600 0.000
active Crohn's disease -1.364 0.038
active ulcerative colitis -1.077 0.022
pediatric high grade glioma -3.000 0.000
pilocytic astrocytoma -1.900 0.000
subependymal giant cell astrocytoma -3.001 0.022
Pick disease -1.100 0.007

Gene RIF (3)

PMID Text
19851445 Observational study of gene-disease association. (HuGE Navigator)
19143821 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19116923 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSSEKSGLPDSVPHTSPPPYNAPQPPAEPPAPPPQAAPSSHHHHHHHYHQSGTATLPRLGAGGLASSAAT      1 - 70
AQRGPSSSATLPRPPHHAPPGPAAGAPPPGCATLPRMPPDPYLQETRFEGPLPPPPPAAAAPPPPAPAQT     71 - 140
AQAPGFVVPTHAGTVGTLPLGGYVAPGYPLQLQPCTAYVPVYPVGTPYAGGTPGGTGVTSTLPPPPQGPG    141 - 210
LALLEPRRPPHDYMPIAVLTTICCFWPTGIIAIFKAVQVRTALARGDMVSAEIASREARNFSFISLAVGI    211 - 280
AAMVLCTILTVVIIIAAQHHENYWDP                                                281 - 306
//

Text Mined References (12)

PMID Year Title
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23326239 2013 A genome-wide integrative genomic study localizes genetic factors influencing antibodies against Epstein-Barr virus nuclear antigen 1 (EBNA-1).
22363774 2012 The dispanins: a novel gene family of ancient origin that contains 14 human members.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19143821 2009 Association of MHC SNP genotype with susceptibility to type 1 diabetes: a modified survival approach.
19116923 2009 Genetic association of the major histocompatibility complex with rheumatoid arthritis implicates two non-DRB1 loci.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
More...