Property Summary

NCBI Gene PubMed Count 10
PubMed Score 18.19
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease -1.364 3.8e-02
active ulcerative colitis -1.077 2.2e-02
adult high grade glioma -2.400 4.1e-06
astrocytoma -1.700 2.1e-25
Astrocytoma, Pilocytic -1.900 5.2e-09
atypical teratoid / rhabdoid tumor -2.700 9.1e-14
ependymoma -1.400 6.0e-03
glioblastoma -2.800 1.1e-11
group 3 medulloblastoma -3.400 1.7e-05
medulloblastoma, large-cell -2.400 7.8e-08
oligodendroglioma -1.700 1.3e-19
osteosarcoma -1.354 7.4e-03
Pick disease -1.100 6.6e-03
primitive neuroectodermal tumor -2.600 2.8e-06
subependymal giant cell astrocytoma -3.001 2.2e-02

Gene RIF (3)

AA Sequence

MSSEKSGLPDSVPHTSPPPYNAPQPPAEPPAPPPQAAPSSHHHHHHHYHQSGTATLPRLGAGGLASSAAT      1 - 70
AQRGPSSSATLPRPPHHAPPGPAAGAPPPGCATLPRMPPDPYLQETRFEGPLPPPPPAAAAPPPPAPAQT     71 - 140
AQAPGFVVPTHAGTVGTLPLGGYVAPGYPLQLQPCTAYVPVYPVGTPYAGGTPGGTGVTSTLPPPPQGPG    141 - 210
LALLEPRRPPHDYMPIAVLTTICCFWPTGIIAIFKAVQVRTALARGDMVSAEIASREARNFSFISLAVGI    211 - 280
AAMVLCTILTVVIIIAAQHHENYWDP                                                281 - 306
//

Text Mined References (12)

PMID Year Title