Property Summary

NCBI Gene PubMed Count 27
PubMed Score 10.08
PubTator Score 16.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Exfoliation Syndrome 12 0.0 0.0
Disease Target Count P-value
tuberculosis 2010 1.4e-06
osteosarcoma 7950 1.1e-04
psoriasis 6694 1.4e-04
Disease Target Count Z-score Confidence
Lipodystrophy 40 3.364 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.260 1.1e-04
psoriasis -1.200 1.4e-04
tuberculosis 1.200 1.4e-06

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MDLWPGAWMLLLLLFLLLLFLLPTLWFCSPSAKYFFKMAFYNGWILFLAVLAIPVCAVRGRNVENMKILR      1 - 70
LMLLHIKYLYGIRVEVRGAHHFPPSQPYVVVSNHQSSLDLLGMMEVLPGRCVPIAKRELLWAGSAGLACW     71 - 140
LAGVIFIDRKRTGDAISVMSEVAQTLLTQDVRVWVFPEGTRNHNGSMLPFKRGAFHLAVQAQVPIVPIVM    141 - 210
SSYQDFYCKKERRFTSGQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG    211 - 280
GGG                                                                       281 - 283
//

Text Mined References (28)

PMID Year Title