Property Summary

NCBI Gene PubMed Count 31
Grant Count 21
R01 Count 12
Funding $1,376,376.66
PubMed Score 14.85
PubTator Score 23.61

Knowledge Summary

Patent

No data available

Expression

 MGI Term (1)

Gene RIF (17)

PMID Text
26183966 we found that RNF5 is differentially expressed in human bronchial epithelia from CF vs. control patients. Our results identify RNF5 as a target for therapeutic modalities to antagonize mutant CFTR proteins.
25759021 RNF5 is involved in the regulation of the L-glutamine carrier proteins SLC1A5 and SLC38A2.
23798571 Our data suggest that RNF5 regulates the turnover of specific G protein-coupled receptors by ubiquitinating JAMP and preventing proteasome recruitment.
22750442 Rma1, an E3 ubiquitin ligase localized in the ER membrane, is involved in Pendrin degradation
22433715 In addition to confirming one of the top findings in the meta-analysis, TRIM26, RNF5 and HLA-DRB3 have been identified as potential candidate genes for schizophrenia.
22190034 HIV-1 gp160 is identified to have a physical interaction with ring finger protein 5, E3 ubiquitin protein ligase (RNF5) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21148293 JB12 cooperates with cytosolic Hsc70 and the ubiquitin ligase RMA1 to target CFTR and CFTRDeltaF508 for degradation.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19285439 E3 ubiquitin ligase RNF5 interacted with MITA in a viral-infection-dependent manner
19269966 RNF5 associates with JAMP in the ER membrane. This association results in Ubc13-dependent RNF5-mediated noncanonical ubiquitination of JAMP.
More...

AA Sequence

MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAG      1 - 70
ISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNA     71 - 140
HEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI                                  141 - 180
//

Text Mined References (37)

PMID Year Title
26183966 2015 Genetic Inhibition Of The Ubiquitin Ligase Rnf5 Attenuates Phenotypes Associated To F508del Cystic Fibrosis Mutation.
25759021 2015 Regulation of glutamine carrier proteins by RNF5 determines breast cancer response to ER stress-inducing chemotherapies.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24019521 2013 RNF185 is a novel E3 ligase of endoplasmic reticulum-associated degradation (ERAD) that targets cystic fibrosis transmembrane conductance regulator (CFTR).
23798571 2013 Novel, gel-free proteomics approach identifies RNF5 and JAMP as modulators of GPCR stability.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22750442 2012 Roles of 17-AAG-induced molecular chaperones and Rma1 E3 ubiquitin ligase in folding and degradation of Pendrin.
More...