Property Summary

NCBI Gene PubMed Count 33
PubMed Score 15.13
PubTator Score 23.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

 MGI Phenotype (1)

Protein-protein Interaction (6)

Gene RIF (17)

AA Sequence

MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAG      1 - 70
ISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFGVGAFPFGFFTTVFNA     71 - 140
HEPFRRGTGVDLGQGHPASSWQDSLFLFLAIFFFFWLLSI                                  141 - 180
//

Text Mined References (40)

PMID Year Title