Property Summary

NCBI Gene PubMed Count 19
PubMed Score 53.18
PubTator Score 33.14

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 4.45287904559859E-76
psoriasis 6685 1.97107961864214E-15
ovarian cancer 8492 4.1620786540206E-9
breast carcinoma 1614 3.36798050908639E-8
lung cancer 4473 1.37928979083373E-5
medulloblastoma, large-cell 6234 8.99564262053149E-5
primary Sjogren syndrome 789 0.00126740115847471
Disease Target Count Z-score Confidence
Priapism 3 4.975 2.5
Burning mouth syndrome 5 4.388 2.2

Gene RIF (2)

18410445 All members of the human opiorphin family of genes can potentially modulate erectile physiology. Both hSMR3 and ProL1 are down-regulated in the corpora of men with ED, and therefore both genes can potentially act as markers of ED.
17101991 Results report the discovery of opiorphin, a previously uncharacterized physiological inhibitor of enkephalin-inactivating zinc ectopeptidases in humans.

AA Sequence

RPHTVLLNATVQVTTSNQTILSSPAFKSFWQKLFAIFG                                    211 - 248

Text Mined References (21)

PMID Year Title
25946035 2015 Human Basal Tear Peptidome Characterization by CID, HCD, and ETD Followed by in Silico and in Vitro Analyses for Antimicrobial Peptide Identification.
25179084 2014 Effects of synthetic analogues of human opiorphin on rat brain opioid receptors.
24900367 2012 Proposed Bioactive Conformations of Opiorphin, an Endogenous Dual APN/NEP Inhibitor.
24855109 2014 Peptides in seminal fluid and their role in infertility: a potential role for opiorphin inhibition of neutral endopeptidase activity as a clinically relevant modulator of sperm motility: a review.
24803544 2014 Opiorphin is a master regulator of the hypoxic response in corporal smooth muscle cells.
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21624966 2011 An update on analgesics.
21145938 2011 The antidepressant-like effect of human opiorphin via opioid-dependent pathways in mice.
20814077 2010 Systemically active human opiorphin is a potent yet non-addictive analgesic without drug tolerance effects.