Property Summary

NCBI Gene PubMed Count 19
PubMed Score 58.02
PubTator Score 33.14

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (2)

AA Sequence

MKLTFFLGLLALISCFTPSESQRFSRRPYLPGQLPPPPLYRPRWVPPSPPPPYDSRLNSPLSLPFVPGRV      1 - 70
PPSSFSRFSQAVILSQLFPLESIRQPRLFPGYPNLHFPLRPYYVGPIRILKPPFPPIPFFLAIYLPISNP     71 - 140
EPQINITTADTTITTNPPTTATATTSTSTKPTMTISSSTVPISSTPEPATSISAATPAASTENTTQILAN    141 - 210
RPHTVLLNATVQVTTSNQTILSSPAFKSFWQKLFAIFG                                    211 - 248
//

Text Mined References (21)

PMID Year Title