Property Summary

NCBI Gene PubMed Count 134
PubMed Score 329.06
PubTator Score 231.96

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Expression

Synonym

Accession Q99933 O75315 Q14414 Q53H32 Q5VZE8 Q5VZE9 Q5VZF0 Q96TG2 Q9Y2V4 BAG-1
Symbols HAP
BAG-1
RAP46

Gene

PDB

1HX1   1WXV   3FZF   3FZH   3FZK   3FZL   3FZM   3LDQ   3M3Z  

  Ortholog (4)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid

Gene RIF (92)

PMID Text
26178413 Bag-1 indirectly affects cell survival through c-Myc activated signalling that causes elevation of ornithine decarboxylase levels, leading to an increase of the polyamine content.
26124006 the combined effects of BAG-1 and XPD polymorphisms on chemotherapy sensitivity and survival in patients with advanced non-small-cell lung cancer, which might be the important predictive markers for platinum-based chemotherapy efficacy.
26087710 Taken together, these data indicate that Bag-1 up-regulation is required to maintain apoptosis resistance in human cytomegalovirus-infected cells.
25962180 Overexpression of miR-138 inhibited cell proliferation by directly suppressing the expression of Bag-1.
25069471 BAG-1 expression was high in esophageal carcinoma tissues compared to normal esophagus. After Eca109 cells were transfected with BAG-1-siRNA, the proliferation and invasive capabilities of the cells were decreased while the apoptosis rate was enhanced.
24969872 Forced Bag-1L expression prevented Cisplatin-induced apoptosis.
24876225 BAG-1M mediates Hsp70 inhibition downstream of NF-kappaB.
24830325 The expression of BAG-1 was upregulated in chronic non-eosinophilic rhinosinusitis.
24557447 distinct isoforms of BAG-1 had different anti-apoptotic ability in breast cancer cells treated with the 4-OH TAM.
24523409 GARRPR in Bag-1L as a novel BF-3 regulatory sequence important for fine-tuning the activity of the AR
24454860 BAG-1M and HspBP1 had differential impacts on the dynamic composition of steroid receptor folding complexes
24318877 we measured the binding of human Hsp72 (HSPA1A) to BAG1, BAG2, BAG3, and the unrelated NEF Hsp105. These studies revealed a clear hierarchy of affinities: BAG3 > BAG1 > Hsp105 >> BAG2.
24061638 The results present that the constructed shRNA plasmids significantly inhibited the expression of mRNA and protein of Lo Vo cell BAG-1, and can maintain the effect for a long term
23852223 BAG1 expression provides significant prognostic information when added to the classical clinicopathological parameters and IHC4, particularly in node-positive patients.
23708800 Chlamydia up-regulate Bag-1 via the MAPK/ERK survival pathway.
23553841 Results for the first time indicated that BAG-1 was dysregulated in HCC and suppression of BAG-1 expression which resulted in inhibiting of NF-kappaB signaling might be developed into a new strategy in HCC therapy.
23322525 BAG-1 expression in meningioma depends upon WHO pathologic classification and is decreased in higher tumor classification
23271418 we identified Caspase 3, BAG1 and BAG3 as key targets of ERalpha in neuronal cells that may play a role in ERalpha-mediated neuroprotection.
23108401 BAG-1 suppresses expression of the key regulatory cytokine transforming growth factor beta (TGF-beta1) in colorectal tumour cells.
23059827 BAG-1 is highly expressed in the majority of colorectal tumours, targeting the Rb-BAG-1 complex to promote apoptosis.
23049684 A peptide sequence derived from the cochaperone Bag-1 modulates the unfolded protein response and induces prostate cancer cell death.(
23023342 Bag1 is expressed at a higher level in functioning- compared to non-functioning pituitary adenomas.
22939115 The expression of anti-apoptosis gene Bcl-2 associated anthanogen-1 (Bag-1), has been associated with outcome in several cancer types, however its prognostic role in pancreatic cancer is unknown.
22454210 Studied expression of BAG-1 and PARP-1 in LSILs, HSILs and SCCs. Research suggests BAG-1 expression could contribute to the differentiation between LSIL and HSIL/SCC whereas PARP-1 could be useful to the differentiation between HSIL HPV-related and SCC.
22439756 ERCC1 and BAG-1 are determinants of survival after surgical treatment of NSCLC, and its mRNA expression in tumor tissues could be used to predict the prognosis of NSCLC treated by platinum.
22179630 Expression of BAG-1 was closely associated with the sensitivity to platinum-based chemotherapeutics in non-small cell lung carcinoma patients.
22016818 BAG1 protein was found highly expressed in children with acute myeloid leukemia
21986497 BAG1 induction is essential for protecting cells from MYC-induced apoptosis.
21809033 Bag-1 protein was found to be overexpressed in colorectal cancer.
21522149 Overexpression of Bag-1 in poorly differentiated SCC may confer both enhanced tumor cell growth and apoptosis resistance. Bag-1 may contribute to the resistance of more advanced epidermal SCC to chemotherapy.
21195059 These data suggest that IGFBP3 and BAG1 may be key markers of radiosensitivity that enhance the susceptibility of squamous cell esophageal cancer to radiotherapy
21157029 Decreased allelic frequency of the BAG-1 rs706118 SNP was observed in patients with frontotemporal lobar degeneration as compared with controls, whereas allelic frequency of the SNP in patients with Alzheimer's disease was similar to controls.
21036726 BAG-1 nuclear isomorph appeared more frequently in grade 2 endometrial tumors than in grade 1 and 3 tumors, and the cytoplasmatic isomorph was expressed more strongly than the nuclear one.
20858459 Bag-1 proteins function as regulators of the action of selective transcription factors.
20855536 Observational study of gene-disease association. (HuGE Navigator)
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20675402 Bag1 induced binding of immature BCR-ABL to proteasome.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20409521 Expression of Bag-1 in colon cancer was closely correlated with pathologic grade, distance metastasis, Duke stage, and prognosis, but it had no effect on the pathologic type, tumor diameter, depth of invasion, and lymphoid node metastasis of the cancer.
20404511 silencing of the BAG-1 gene resulted in changes in expression of apoptosis-related genes and sensitized A549 and L9981 cells to cisplatin-induced apoptosis.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20156966 Wild-type DJ-1 possesses chaperone activity, which is abolished by the L166P mutation which is reversed by the expression of the cochaperone BAG1.
20096920 aberrant expression and subcellular distribution of Bag-1 might play an important role in the malignant transformation of gastric epithelial cells and should be considered as a biomarker for gastric carcinogenesis, subsequent progression, and prognosis.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19881545 BAG-1's effects were associated with an activation of RAF-1-a known binding partner of BAG-1, enhanced signaling through the MAP kinase pathway and a decrease in BIM expression.
19778524 These results indicate that ATP hydrolysis is essential for Bag-1M-mediated inhibition of the DNA binding by the GR and Hsp70 is a mediator for this process.
19595997 These findings indicate a novel mechanism by which Bag-1M acts as a corepressor and downregulates the activity of the glucocorticoid receptor.
19546472 Advanced osteoarthritis is associated with altered collagen VI expression and upregulation of ER-stress markers Grp78 and bag-1.
19317853 we report a specific increase of BAG-1M in human Alzheimer's disease patients
19293798 BAG-1 inhibits the transactivating functions of p73 and provide new insight into the mechanisms that control the expression of p73.
19243896 The results of our study showed that overall cytoplasmic and nuclear BAG-1 expression and overall and cytoplasmic CD24 expression, correlates with adverse prognostic parameters for breast carcinoma.
19151744 Distinct isoforms of BAG-1 have different anti-apoptotic functions in breast cancer cells, and that the BAG-1 p50 isoform can potentiate the role of estrogen in ER-positive breast cancer.
19066611 A high BAG-1 expression predicts improved patient outcome in estrogen receptor-positive breast carcinoma.
18822299 These findings identify a regulatory mechanism, downstream of hormone binding, used by Bag-1M for attenuating GR action in response to its changing cellular levels.
18805052 Gene expression revealed up-regulation of pro-angiogenic (PGF), anti-apoptotics (BAG-1, BCL-2), heart development (TNNT2, TNNC1) and extracellular matrix remodelling (MMP-2, MMP-7) genes in SM.
18684711 Bag1 NEF increased refolding by Hsc70 and DJA2, as did the newly characterized NEF Hsp110
18523358 BAG-1 protein was deregulated in this disease similar to some other malignancies such as breast and colon cancer
18430249 Bag-1 expression in breast tumors is associated with improved outcome and steroid receptor positivity.
18413740 Chromatin immunoprecipitation analysis of the BAG-1 promoter in DNMT1-overexpressing or DNMT3B-overexpressing colon cells show a permissive chromatin status assoscsiated with DNA binding of BORIS.
18204076 By inhibiting NF-kappaB, suppression of BAG-1 could represent a novel strategy to impede colorectal cancer cell survival and as an adjuvant increase sensitivity to current therapeutic regimes.
17954934 BAG-1 associates with Tau protein in an Hsc70-dependent manner.
17950682 Modulation of Bag-1 expression can therefore mediate chondrocyte differentiation and turnover
17700523 BAG-1 mRNA internal ribosome entry segment maintains synthesis of BAG-1 protein following exposure of cells to the chemotoxic drug vincristine but not to cisplatin.
17693608 Results suggest that BAG-1 is able to potentiate vitamin D receptor-mediated transactivation by acting as a nuclear chaperone for 1,25(OH)2D3.
17662274 BAG-1L endogenously regulates gene expression by potentiating nuclear hormone receptor function and a role for BAG-1L in 24-hydroxylase regulation of vitamin D metabolism and the cellular response of oral keratinocytes to 1alpha,25-dihydroxyvitamin D3.
17657847 over-expression of BAG1 may play an important role in genesis and development of colon carcinoma
17549665 An antiapoptotic protein, BAG-1, was found to be down-regulated in chewing-tobacco-mediated tongue carcinogenesis.
17278878 This is the molecular basis for their effects (Hap50/BAG-1L) on transcriptional activities, which are emphasized in this review and for which a molecular model is presented.
16482527 Increased cytosolic and nuclear BAG-1 expression may denote more aggressive variants of prostate cancer.
16457154 BAG-1 protein showed distinct distribution pattern in hyperplastic and neoplastic prostate. BAG-1 with BCL-2 inhibits apoptosis and may prolong the life of neoplastic cells and give them a chance to gain new oncogenic features in early carcinogenesis.
16398049 Overexpression of BAG-1 and p53 plays an important role in the process laryngeal squamous cell carcinoma development.
16292491 In astrocytic tumours low ERbeta expression correlated significantly with high grade, higher expression of cytoplasmic BAG-1 and worse survival.
16042572 BAG-1 may promote colorectal tumour cell survival by making colonic epithelial cells less sensitive to DNA damage.
15843891 BAG-1 expression inhibits apoptosis in colorectal adenoma-derived epithelial cells
15831476 BAG1 activates Hsp70, which is important for neuroprotectivity.
15707960 The results of this study implicate BAG-1 p29 in the regulation of both the EGF signaling cascade and the apoptotic cascade induced by loss of anchorage.
15309313 Observational study of gene-disease association. (HuGE Navigator)
15297164 BAG-1 is expressed in the endometrium. High-grade cancers stain more frequently than secretory endometrium for both cytoplasmic and nuclear BAG-1 expression, perhaps indicating an association between expression of BAG-1 and prognosis.
15199607 BAG-1 contributes an important cellular function to breast epithelial cells, which is reflected by its ubiquitous expression in these tissues, but does not appear to determine response to doxorubicin-based chemotherapy
15169918 a secondary structural model of the Bag-1 IRES has been derived by using chemical and enzymatic probing data as constraints on the RNA folding algorithm Mfold
15075668 P. 130:..."[h]igh expression of Bcl-2", was one of the predictive factors "for achievement of pathological remission after preoperative chemotherapy" containing anthracycline.
14978028 Recombinant BAG-1 can influence cellular response to stress in cardiomyocytes by multiple mechanisms, potentially influenced by the cell type and nature of the stress signal.
14680805 Our experiments suggest that BAG-1 inhibits anti-cancer drug-induced apoptosis through apoptosis regulation pathways that may involve the mitochondrial Bcl-2/Bax ratio, p53, and differential anti-cancer drug-mediated cytochrome c release.
14532969 BAG-1 is targeted to the COPI coated structures, implying its contribution toward the COPI vesicular transport in gastrointestinal epithelial cells
14517289 Bag-1L enhances androgen receptor action via interaction with the NH2-terminal region of the receptor
12874020 BAG-1-mediated resistance to stress-induced growth inhibition is likely to have a major impact on the development and response to therapy of breast cancer.
12724406 BAG-1 may function to suppress the GADD34-mediated cellular stress response and have a role in the survival of cells undergoing stress
12402153 nuclear BAG-1 expression is a useful predictive factor for distant metastasis and a poor prognosis in patients with colorectal cancer.
12049201 BAG-1, an anti-apoptotic tumour marker Review
11994280 HIV-1 Tat upregulates the expression of BAG-1 in Kaposi's sarcoma cells
9679980 Alternate protein isoforms arise through the use of a non-AUG (CUG) codon in addition to downstream in-frame AUG codons.
9396724 The longer p50 isoform is generated through the use of an upstream, in-frame, non-AUG (CUG) translation initiation codon.

AA Sequence

MAQRGGARRPRGDRERLGSRLRALRPGREPRQSEPPAQRGPPPSGRPPARSTASGHDRPTRGAAAGARRP      1 - 70
RMKKKTRRRSTRSEELTRSEELTLSEEATWSEEATQSEEATQGEEMNRSQEVTRDEESTRSEEVTREEMA     71 - 140
AAGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEVIGVPQSFQKLIFKGKSLKEMETPLSALGIQ    141 - 210
DGCRVMLIGKKNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKA    211 - 280
TIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE         281 - 345
//

Text Mined References (137)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26178413 2015 Bag-1 promotes cell survival through c-Myc-mediated ODC upregulation that is not preferred under apoptotic stimuli in MCF-7 cells.
26124006 2015 Association between polymorphisms of BAG-1 and XPD and chemotherapy sensitivity in advanced non-small-cell lung cancer patients treated with vinorelbine combined cisplatin regimen.
26087710 2015 Human cytomegalovirus inhibits apoptosis involving upregulation of the antiapoptotic protein Bag-1.
25962180 2015 MiR-138 Suppresses Cell Proliferation by Targeting Bag-1 in Gallbladder Carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25069471 2014 Expression of BAG-1 is closely related to cell differentiation and TNM stage in esophageal cancer and its downregulation inhibits the proliferation and invasion of human esophageal carcinoma cells.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24969872 2014 Bag-1L is a stress-withstand molecule prevents the downregulation of Mcl-1 and c-Raf under control of heat shock proteins in cisplatin treated HeLa cervix cancer cells.
24876225 2014 The BAG-1 isoform BAG-1M regulates keratin-associated Hsp70 chaperoning of aPKC in intestinal cells during activation of inflammatory signaling.
24830325 2014 Expression and role of BAG-1 in eosinophilic and non-eosinophilic chronic rhinosinusitis with nasal polyps.
24557447 2014 Modulation of BAG-1 expression alters the sensitivity of breast cancer cells to tamoxifen.
24523409 2014 Coregulator control of androgen receptor action by a novel nuclear receptor-binding motif.
24454860 2014 Hsp70 cochaperones HspBP1 and BAG-1M differentially regulate steroid hormone receptor function.
24318877 2014 Binding of human nucleotide exchange factors to heat shock protein 70 (Hsp70) generates functionally distinct complexes in vitro.
24061638 2014 Antiapoptotic gene BAG-1 vector structure of RNA interference and endogenous targeted screening in colon cancer cell lines.
23852223 2013 Immunohistochemical BAG1 expression improves the estimation of residual risk by IHC4 in postmenopausal patients treated with anastrazole or tamoxifen: a TransATAC study.
23708800 2013 Chlamydia inhibit host cell apoptosis by inducing Bag-1 via the MAPK/ERK survival pathway.
23553841 2013 Overexpressed nuclear BAG-1 in human hepatocellular carcinoma is associated with poor prognosis and resistance to doxorubicin.
23322525 2013 BAG-1 expression in human meningioma and correlation with clinical characteristics.
23271418 2013 Differential regulation of apoptosis-associated genes by estrogen receptor alpha in human neuroblastoma cells.
23108401 2013 BAG-1 suppresses expression of the key regulatory cytokine transforming growth factor ? (TGF-?1) in colorectal tumour cells.
23059827 2012 The retinoblastoma protein (Rb) as an anti-apoptotic factor: expression of Rb is required for the anti-apoptotic function of BAG-1 protein in colorectal tumour cells.
23049684 2012 A peptidic unconjugated GRP78/BiP ligand modulates the unfolded protein response and induces prostate cancer cell death.
23023342 2012 Expression of genes FOLR1, BAG1 and LAPTM4B in functioning and non-functioning pituitary adenomas.
22939115 2013 Bcl-2 associated anthanogen-1 (Bag-1) expression and prognostic value in pancreatic head and periampullary cancer.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22454210 2012 Expression of BAG-1 and PARP-1 in precursor lesions and invasive cervical cancer associated with human papillomavirus (HPV).
22439756 2012 Combined analysis of mRNA expression of ERCC1, BAG-1, BRCA1, RRM1 and TUBB3 to predict prognosis in patients with non-small cell lung cancer who received adjuvant chemotherapy.
22179630 2012 The role of expression and polymorphism of the BAG-1 gene in response to platinum-based chemotherapeutics in NSCLC.
22016818 2011 BAG1: the guardian of anti-apoptotic proteins in acute myeloid leukemia.
21986497 2011 Inhibition of the single downstream target BAG1 activates the latent apoptotic potential of MYC.
21809033 2011 Correlation between the expression of the BAG-1 gene and clinicopathologic factors in colorectal cancer.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21522149 2011 Co-overexpression of Bag-1 and heat shock protein 70 in human epidermal squamous cell carcinoma: Bag-1-mediated resistance to 5-fluorouracil-induced apoptosis.
21195059 2011 IGFBP3 and BAG1 enhance radiation-induced apoptosis in squamous esophageal cancer cells.
21157029 2011 BAG1 is a protective factor for sporadic frontotemporal lobar degeneration but not for Alzheimer's disease.
21036726 2010 Isomorph expression of BAG-1 gene, ER and PR in endometrial cancer.
20858459 2010 Depletion of the cellular levels of Bag-1 proteins attenuates phorbol ester-induced downregulation of I?B? and nuclear accumulation of NF-?B.
20855536 2010 Germline variation in apoptosis pathway genes and risk of non-Hodgkin's lymphoma.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20675402 2010 Bag1 directly routes immature BCR-ABL for proteasomal degradation.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20409521 2010 Expressions of the anti-apoptotic genes Bag-1 and Bcl-2 in colon cancer and their relationship.
20404511 2010 Gene silencing of BAG-1 modulates apoptotic genes and sensitizes lung cancer cell lines to cisplatin-induced apoptosis.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20156966 2010 BAG1 restores formation of functional DJ-1 L166P dimers and DJ-1 chaperone activity.
20096920 2010 Nuclear or cytoplasmic localization of Bag-1 distinctly correlates with pathologic behavior and outcome of gastric carcinomas.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19881545 2010 BAG-1 overexpression attenuates luminal apoptosis in MCF-10A mammary epithelial cells through enhanced RAF-1 activation.
19800331 2009 Short peptides derived from the BAG-1 C-terminus inhibit the interaction between BAG-1 and HSC70 and decrease breast cancer cell growth.
19778524 2009 ATP hydrolysis is essential for Bag-1M-mediated inhibition of the DNA binding by the glucocorticoid receptor.
19595997 2009 Bag-1M inhibits the transactivation of the glucocorticoid receptor via recruitment of corepressors.
19546472 2009 Advanced osteoarthritis in humans is associated with altered collagen VI expression and upregulation of ER-stress markers Grp78 and bag-1.
19317853 2009 BAG-1M is up-regulated in hippocampus of Alzheimer's disease patients and associates with tau and APP proteins.
19293798 2009 The BAG-1 cochaperone is a negative regulator of p73-dependent transcription.
19243896 2009 CD24 expression has a prognostic impact in breast carcinoma.
19151744 2009 Different BAG-1 isoforms have distinct functions in modulating chemotherapeutic-induced apoptosis in breast cancer cells.
19066611 2009 BAG-1 predicts patient outcome and tamoxifen responsiveness in ER-positive invasive ductal carcinoma of the breast.
19060904 2009 An empirical framework for binary interactome mapping.
18822299 2008 Bag-1M is a component of the in vivo DNA-glucocorticoid receptor complex at hormone-regulated promoter.
18805052 2008 Characterization of the paracrine effects of human skeletal myoblasts transplanted in infarcted myocardium.
18684711 2008 Functional divergence between co-chaperones of Hsc70.
18523358 2008 Bcl-2 associated athanogene-1 overexpression in diffuse large B-cell lymphoma.
18430249 2008 Expression patterns and prognostic value of Bag-1 and Bcl-2 in breast cancer.
18413740 2008 DNA methyltransferase 1 and 3B activate BAG-1 expression via recruitment of CTCFL/BORIS and modulation of promoter histone methylation.
18204076 2008 BAG-1 is up-regulated in colorectal tumour progression and promotes colorectal tumour cell survival through increased NF-kappaB activity.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17954934 2007 BAG-1 associates with Hsc70.Tau complex and regulates the proteasomal degradation of Tau protein.
17950682 2008 Bcl-2-associated athanogene-1 (BAG-1): a transcriptional regulator mediating chondrocyte survival and differentiation during endochondral ossification.
17700523 2008 Regulation of BAG-1 IRES-mediated translation following chemotoxic stress.
17693608 2007 Co-chaperone potentiation of vitamin D receptor-mediated transactivation: a role for Bcl2-associated athanogene-1 as an intracellular-binding protein for 1,25-dihydroxyvitamin D3.
17662274 2007 Subcellular localisation of BAG-1 and its regulation of vitamin D receptor-mediated transactivation and involucrin expression in oral keratinocytes: implications for oral carcinogenesis.
17657847 2007 Clinicopathologic significance of BAG1 and TIMP3 expression in colon carcinoma.
17549665 Cytoplasmic localization of BAG-1 in leukoplakia and carcinoma of the tongue: correlation with p53 and c-erbB2 in carcinoma.
17278878 2006 Activities of the cochaperones Hap46/BAG-1M and Hap50/BAG-1L and isoforms.
16482527 2006 Expression of BAG-1 protein correlates with aggressive behavior of prostate cancers.
16457154 BAG-1 expression in hyperplastic and neoplastic prostate tissue: is there any relationship with BCL-related proteins and androgen receptor status?
16398049 2005 [Expression of BAG-1 and p53 in laryngeal squamous cell carcinoma and their clinical significance].
16381901 2006 The LIFEdb database in 2006.
16292491 2006 Estrogen receptor beta (ERbeta) protein expression correlates with BAG-1 and prognosis in brain glial tumours.
16042572 2005 The role of the retinoblastoma protein (Rb) in the nuclear localization of BAG-1: implications for colorectal tumour cell survival.
15986447 2005 Characterization of Hap/BAG-1 variants as RP1 binding proteins with antiapoptotic activity.
15843891 2005 Nuclear BAG-1 expression inhibits apoptosis in colorectal adenoma-derived epithelial cells.
15831476 2005 Interaction of BAG1 and Hsp70 mediates neuroprotectivity and increases chaperone activity.
15707960 2005 BAG-1 p29 protein prevents drug-induced cell death in the presence of EGF and enhances resistance to anoikis in SKOV3 human ovarian cancer cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15309313 2004 Screening for candidate gene regions in narcolepsy using a microsatellite based approach and pooled DNA.
15297164 2004 BAG-1 expression in normal and neoplastic endometrium.
15199607 2004 Expression of BAG-1 and BcL-2 proteins before and after neoadjuvant chemotherapy of locally advanced breast cancer.
15169918 2004 Bag-1 internal ribosome entry segment activity is promoted by structural changes mediated by poly(rC) binding protein 1 and recruitment of polypyrimidine tract binding protein 1.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15075668 2004 Only grading has independent impact on breast cancer survival after adjustment for pathological response to preoperative chemotherapy.
14978028 2004 BAG-1 proteins protect cardiac myocytes from simulated ischemia/reperfusion-induced apoptosis via an alternate mechanism of cell survival independent of the proteasome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14680805 2003 Antisense BAG-1 sensitizes HeLa cells to apoptosis by multiple pathways.
14532969 2003 Accumulation of Hsp70/Hsc70 molecular chaperone regulator BAG-1 on COPI-coated structures in gastric epithelial cells.
14517289 2003 The cochaperone Bag-1L enhances androgen receptor action via interaction with the NH2-terminal region of the receptor.
12874020 2003 BAG-1 prevents stress-induced long-term growth inhibition in breast cancer cells via a chaperone-dependent pathway.
12853476 2003 Cofactor Tpr2 combines two TPR domains and a J domain to regulate the Hsp70/Hsp90 chaperone system.
12845674 2003 The retinoblastoma protein interacts with Bag-1 in human colonic adenoma and carcinoma derived cell lines.
12724406 2003 Human BAG-1 proteins bind to the cellular stress response protein GADD34 and interfere with GADD34 functions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12402153 2002 Nuclear BAG-1 expression reflects malignant potential in colorectal carcinomas.
12049201 2002 BAG-1, an anti-apoptotic tumour marker.
11994280 2002 HIV-1-Tat protein activates phosphatidylinositol 3-kinase/ AKT-dependent survival pathways in Kaposi's sarcoma cells.
11741305 2001 The carboxyl-terminal lobe of Hsc70 ATPase domain is sufficient for binding to BAG1.
11676916 2001 Cooperation of a ubiquitin domain protein and an E3 ubiquitin ligase during chaperone/proteasome coupling.
11340068 2001 BAG-1 is a novel cytoplasmic binding partner of the membrane form of heparin-binding EGF-like growth factor: a unique role for proHB-EGF in cell survival regulation.
11278763 2001 Structure-function analysis of Bag1 proteins. Effects on androgen receptor transcriptional activity.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11231577 2001 Bag1-Hsp70 mediates a physiological stress signalling pathway that regulates Raf-1/ERK and cell growth.
11222862 2001 Structure of a Bag/Hsc70 complex: convergent functional evolution of Hsp70 nucleotide exchange factors.
11101523 2000 Hsp70-RAP46 interaction in downregulation of DNA binding by glucocorticoid receptor.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10967105 2000 BAG1L enhances trans-activation function of the vitamin D receptor.
10816573 2000 Human DnaJ homologs dj2 and dj3, and bag-1 are positive cochaperones of hsc70.
10671488 2000 The ubiquitin-related BAG-1 provides a link between the molecular chaperones Hsc70/Hsp70 and the proteasome.
10477749 1999 A nuclear action of the eukaryotic cochaperone RAP46 in downregulation of glucocorticoid receptor activity.
10467399 1999 Cloning and characterization of the human BAG-1 gene promoter: upregulation by tumor-derived p53 mutants.
9873016 1999 An evolutionarily conserved family of Hsp70/Hsc70 molecular chaperone regulators.
9747877 1998 Human BAG-1/RAP46 protein is generated as four isoforms by alternative translation initiation and overexpressed in cancer cells.
9679980 1998 Expression and location of Hsp70/Hsc-binding anti-apoptotic protein BAG-1 and its variants in normal tissues and tumor cell lines.
9642262 1998 Interaction of BAG-1 with retinoic acid receptor and its inhibition of retinoic acid-induced apoptosis in cancer cells.
9603979 1998 RAP46 is a negative regulator of glucocorticoid receptor action and hormone-induced apoptosis.
9582267 1998 p53-inducible human homologue of Drosophila seven in absentia (Siah) inhibits cell growth: suppression by BAG-1.
9396724 1997 Mammalian cells express two differently localized Bag-1 isoforms generated by alternative translation initiation.
9305631 1997 BAG-1 modulates the chaperone activity of Hsp70/Hsc70.
8947043 1996 HGF receptor associates with the anti-apoptotic protein BAG-1 and prevents cell death.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8812483 1996 Cloning of cDNAs encoding the human BAG1 protein and localization of the human BAG1 gene to chromosome 9p12.
8692945 1996 Bcl-2 interacting protein, BAG-1, binds to and activates the kinase Raf-1.
8524784 1995 A protein that interacts with members of the nuclear hormone receptor family: identification and cDNA cloning.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7834747 1995 Cloning and functional analysis of BAG-1: a novel Bcl-2-binding protein with anti-cell death activity.