Property Summary

NCBI Gene PubMed Count 134
Grant Count 70
R01 Count 41
Funding $7,874,944.51
PubMed Score 329.06
PubTator Score 231.96

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q99933 O75315 Q14414 Q53H32 Q5VZE8 Q5VZE9 Q5VZF0 Q96TG2 Q9Y2V4 BAG-1
Symbols HAP
BAG-1
RAP46

Gene

PDB

1HX1   1WXV   3FZF   3FZH   3FZK   3FZL   3FZM   3LDQ   3M3Z  

Gene RIF (92)

PMID Text
26178413 Bag-1 indirectly affects cell survival through c-Myc activated signalling that causes elevation of ornithine decarboxylase levels, leading to an increase of the polyamine content.
26124006 the combined effects of BAG-1 and XPD polymorphisms on chemotherapy sensitivity and survival in patients with advanced non-small-cell lung cancer, which might be the important predictive markers for platinum-based chemotherapy efficacy.
26087710 Taken together, these data indicate that Bag-1 up-regulation is required to maintain apoptosis resistance in human cytomegalovirus-infected cells.
25962180 Overexpression of miR-138 inhibited cell proliferation by directly suppressing the expression of Bag-1.
25069471 BAG-1 expression was high in esophageal carcinoma tissues compared to normal esophagus. After Eca109 cells were transfected with BAG-1-siRNA, the proliferation and invasive capabilities of the cells were decreased while the apoptosis rate was enhanced.
24969872 Forced Bag-1L expression prevented Cisplatin-induced apoptosis.
24876225 BAG-1M mediates Hsp70 inhibition downstream of NF-kappaB.
24830325 The expression of BAG-1 was upregulated in chronic non-eosinophilic rhinosinusitis.
24557447 distinct isoforms of BAG-1 had different anti-apoptotic ability in breast cancer cells treated with the 4-OH TAM.
24523409 GARRPR in Bag-1L as a novel BF-3 regulatory sequence important for fine-tuning the activity of the AR
More...

AA Sequence

MAQRGGARRPRGDRERLGSRLRALRPGREPRQSEPPAQRGPPPSGRPPARSTASGHDRPTRGAAAGARRP      1 - 70
RMKKKTRRRSTRSEELTRSEELTLSEEATWSEEATQSEEATQGEEMNRSQEVTRDEESTRSEEVTREEMA     71 - 140
AAGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEVIGVPQSFQKLIFKGKSLKEMETPLSALGIQ    141 - 210
DGCRVMLIGKKNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKA    211 - 280
TIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQETERLQSTNFALAE         281 - 345
//

Publication (137)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26178413 2015 Bag-1 promotes cell survival through c-Myc-mediated ODC upregulation that is not preferred under apoptotic stimuli in MCF-7 cells.
26124006 2015 Association between polymorphisms of BAG-1 and XPD and chemotherapy sensitivity in advanced non-small-cell lung cancer patients treated with vinorelbine combined cisplatin regimen.
26087710 2015 Human cytomegalovirus inhibits apoptosis involving upregulation of the antiapoptotic protein Bag-1.
25962180 2015 MiR-138 Suppresses Cell Proliferation by Targeting Bag-1 in Gallbladder Carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25069471 2014 Expression of BAG-1 is closely related to cell differentiation and TNM stage in esophageal cancer and its downregulation inhibits the proliferation and invasion of human esophageal carcinoma cells.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24969872 2014 Bag-1L is a stress-withstand molecule prevents the downregulation of Mcl-1 and c-Raf under control of heat shock proteins in cisplatin treated HeLa cervix cancer cells.
24876225 2014 The BAG-1 isoform BAG-1M regulates keratin-associated Hsp70 chaperoning of aPKC in intestinal cells during activation of inflammatory signaling.
More...