Property Summary

NCBI Gene PubMed Count 14
PubMed Score 9.29
PubTator Score 24.52

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.37345500168103E-11
posterior fossa group B ependymoma 1530 1.25486949275765E-8
malignant mesothelioma 3163 1.14639193306401E-7
nasopharyngeal carcinoma 1056 1.94495921294962E-6
glioblastoma 5572 2.21272993765511E-6
psoriasis 6685 1.0105140554141E-5
medulloblastoma, large-cell 6234 2.30986483146784E-5
adult high grade glioma 2148 7.93877265488453E-5
atypical teratoid / rhabdoid tumor 4369 1.12823814937517E-4
Breast cancer 3099 5.16303340432174E-4
medulloblastoma 1524 0.00248430195408922
non primary Sjogren syndrome sicca 840 0.0119862034564148
chronic rhinosinusitis 512 0.0244154701493333

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
psoriasis -3.000 0.000
osteosarcoma -3.108 0.000
posterior fossa group B ependymoma 2.700 0.000
atypical teratoid / rhabdoid tumor -1.300 0.000
glioblastoma -1.500 0.000
medulloblastoma -1.100 0.002
medulloblastoma, large-cell -1.500 0.000
adult high grade glioma -1.600 0.000
non primary Sjogren syndrome sicca 1.100 0.012
nasopharyngeal carcinoma -1.100 0.000
Breast cancer -1.100 0.001
chronic rhinosinusitis -1.068 0.024

Synonym

Accession Q99932 B4DY89 E9PDV6 Q12937 Q5TCV8 Q8WWB4
Symbols SMP1
BS-84
CT142
HSD-1
SPAG3
CILD28
hSMP-1

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG

Gene RIF (3)

PMID Text
20488182 Results indicate that SPAG8 acts as a regulator of ACT and plays an important role in CREM-ACT-mediated gene transcription during spermatogenesis.
19548270 Sperm associated antigen 8 might be involved in the regulation of cell cycle by changing the phosphorylation level of Tyr15 on CDC2 Protein Kinase.
17187156 The antibody of this recombinant protein inhibits the mouse acrosome reaction and prmits mouse sperm-zona pellucida binding.

AA Sequence

METNESTEGSRSRSRSLDIQPSSEGLGPTSEPFPSSDDSPRSALAAATAAAAAAASAAAATAAFTTAKAA      1 - 70
ALSTKTPAPCSEFMEPSSDPSLLGEPCAGPGFTHNIAHGSLGFEPVYVSCIAQDTCTTTDHSSNPGPVPG     71 - 140
SSSGPVLGSSSGAGHGSGSGSGPGCGSVPGSGSGPGPGSGPGSGPGHGSGSHPGPASGPGPDTGPDSELS    141 - 210
PCIPPGFRNLVADRVPNYTSWSQHCPWEPQKQPPWEFLQVLEPGARGLWKPPDIKGKLMVCYETLPRGQC    211 - 280
LLYNWEEERATNHLDQVPSMQDGSESFFFRHGHRGLLTMQLKSPMPSSTTQKDSYQPPGNVYWPLRGKRE    281 - 350
AMLEMLLQHQICKEVQAEQEPTRKLFEVESVTHHDYRMELAQAGTPAPTKPHDYRQEQPETFWIQRAPQL    351 - 420
PVCEGD                                                                    421 - 426
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20488182 2010 Sperm associated antigen 8 (SPAG8), a novel regulator of activator of CREM in testis during spermatogenesis.
19548270 2009 Regulation of the G2/M phase of the cell cycle by sperm associated antigen 8 (SPAG8) protein.
17187156 2007 Inhibition of mouse acrosome reaction and sperm-zona pellucida binding by anti-human sperm membrane protein 1 antibody.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
15014887 2004 Sperm membrane protein (hSMP-1) and RanBPM complex in the microtubule-organizing centre.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11111873 Human sperm membrane protein (hSMP-1): a developmental testis-specific component during germ cell differentiation.
More...