Property Summary

NCBI Gene PubMed Count 22
PubMed Score 61.95
PubTator Score 41.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Colonic Neoplasms 126
Disease Target Count P-value
tuberculosis 1563 2.81274855386261E-5
interstitial cystitis 2299 2.11437222526194E-4
osteosarcoma 7933 0.00281304467391849
invasive ductal carcinoma 2950 0.00466986316669022
lung adenocarcinoma 2714 0.00589563810566625
ductal carcinoma in situ 1745 0.0190652908220341
Disease Target Count Z-score Confidence
Prostate cancer 172 0.0 2.0
Type 1 diabetes mellitus 104 0.0 2.0
Disease Target Count Z-score Confidence
Beckwith-Wiedemann syndrome 46 4.553 2.3

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.002 0.003
tuberculosis 1.600 0.000
interstitial cystitis -1.400 0.000
lung adenocarcinoma 1.100 0.006
ductal carcinoma in situ 1.200 0.019
invasive ductal carcinoma 1.200 0.005

Synonym

Accession Q99929 Q6PEY9 Q9UM68 ASH-2
Symbols ASH2
HASH2
MASH2
bHLHa45

Gene

  Ortholog (6)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid

Gene RIF (13)

PMID Text
26483561 expression of ASCL2 may identify an aggressive subgroup in lung squamous cell carcinoma
26307678 Ascl2 over-expression is associated with colorectal neoplasms.
25866254 SEMA3F functions as a suppressor of colorectal cancer metastasis by down-regulating the ASCL2-CXCR4 signaling axis.
25371200 ASCL2 gene expression is regulated by miR-200a/b/c, miR-141 and miR429 levels in colon cancer.
25277775 SNAIL1 combines competitive displacement of ASCL2 and epigenetic mechanisms to rapidly silence the EPHB3 tumor suppressor in colorectal cancer.
24463518 Ascl2 directly initiates follicular T-helper cell development
23181270 These results suggest that ASCL2 might play an important role in gastric tumor growth and chemoresistance.
22384170 Ascl2 knockdown results in tumor growth arrest by miRNA-302b-related inhibition of colon cancer progenitor cells
20479215 a stem cell specific transcription signature promoted by ASCL2 has been identified to be upregulated in a subset of liver metastases, those characterised by an 11p15.5 gain
17165436 Negative expression of HASH2 in complete hydatidiform moles (CM) but positive expression in malignant tumors suggests the presence of a specific mechanism for inactivation of the HASH2 gene in CM and reactivation in invasive moles or choriocarcinoma
More...

AA Sequence

MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGF      1 - 70
QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVA     71 - 140
ASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY                     141 - 193
//

Text Mined References (25)

PMID Year Title
26483561 2016 Elevated expression of ASCL2 is an independent prognostic indicator in lung squamous cell carcinoma.
26307678 2015 Achaete scute-like 2 suppresses CDX2 expression and inhibits intestinal neoplastic epithelial cell differentiation.
25866254 2015 SEMA3F prevents metastasis of colorectal cancer by PI3K-AKT-dependent down-regulation of the ASCL2-CXCR4 axis.
25371200 2014 MicroRNA-200 (miR-200) cluster regulation by achaete scute-like 2 (Ascl2): impact on the epithelial-mesenchymal transition in colon cancer cells.
25277775 2015 SNAIL1 combines competitive displacement of ASCL2 and epigenetic mechanisms to rapidly silence the EPHB3 tumor suppressor in colorectal cancer.
25102180 2014 Meta-analysis of genome-wide association studies in African Americans provides insights into the genetic architecture of type 2 diabetes.
24463518 2014 Transcription factor achaete-scute homologue 2 initiates follicular T-helper-cell development.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23181270 2013 Aberrant upregulation of ASCL2 by promoter demethylation promotes the growth and resistance to 5-fluorouracil of gastric cancer cells.
23178126 2012 Microcephaly gene links trithorax and REST/NRSF to control neural stem cell proliferation and differentiation.
More...