Property Summary

NCBI Gene PubMed Count 22
Grant Count 38
R01 Count 23
Funding $2,695,215.82
PubMed Score 61.95
PubTator Score 41.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.002 0.003
tuberculosis 1.600 0.000
interstitial cystitis -1.400 0.000
lung adenocarcinoma 1.100 0.006
ductal carcinoma in situ 1.200 0.019
invasive ductal carcinoma 1.200 0.005

Gene RIF (13)

PMID Text
26483561 expression of ASCL2 may identify an aggressive subgroup in lung squamous cell carcinoma
26307678 Ascl2 over-expression is associated with colorectal neoplasms.
25866254 SEMA3F functions as a suppressor of colorectal cancer metastasis by down-regulating the ASCL2-CXCR4 signaling axis.
25371200 ASCL2 gene expression is regulated by miR-200a/b/c, miR-141 and miR429 levels in colon cancer.
25277775 SNAIL1 combines competitive displacement of ASCL2 and epigenetic mechanisms to rapidly silence the EPHB3 tumor suppressor in colorectal cancer.
24463518 Ascl2 directly initiates follicular T-helper cell development
23181270 These results suggest that ASCL2 might play an important role in gastric tumor growth and chemoresistance.
22384170 Ascl2 knockdown results in tumor growth arrest by miRNA-302b-related inhibition of colon cancer progenitor cells
20479215 a stem cell specific transcription signature promoted by ASCL2 has been identified to be upregulated in a subset of liver metastases, those characterised by an 11p15.5 gain
17165436 Negative expression of HASH2 in complete hydatidiform moles (CM) but positive expression in malignant tumors suggests the presence of a specific mechanism for inactivation of the HASH2 gene in CM and reactivation in invasive moles or choriocarcinoma
More...

AA Sequence

MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGF      1 - 70
QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVA     71 - 140
ASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY                     141 - 193
//

Text Mined References (25)

PMID Year Title
26483561 2016 Elevated expression of ASCL2 is an independent prognostic indicator in lung squamous cell carcinoma.
26307678 2015 Achaete scute-like 2 suppresses CDX2 expression and inhibits intestinal neoplastic epithelial cell differentiation.
25866254 2015 SEMA3F prevents metastasis of colorectal cancer by PI3K-AKT-dependent down-regulation of the ASCL2-CXCR4 axis.
25371200 2014 MicroRNA-200 (miR-200) cluster regulation by achaete scute-like 2 (Ascl2): impact on the epithelial-mesenchymal transition in colon cancer cells.
25277775 2015 SNAIL1 combines competitive displacement of ASCL2 and epigenetic mechanisms to rapidly silence the EPHB3 tumor suppressor in colorectal cancer.
25102180 2014 Meta-analysis of genome-wide association studies in African Americans provides insights into the genetic architecture of type 2 diabetes.
24463518 2014 Transcription factor achaete-scute homologue 2 initiates follicular T-helper-cell development.
23936387 2013 A possible mechanism behind autoimmune disorders discovered by genome-wide linkage and association analysis in celiac disease.
23181270 2013 Aberrant upregulation of ASCL2 by promoter demethylation promotes the growth and resistance to 5-fluorouracil of gastric cancer cells.
23178126 2012 Microcephaly gene links trithorax and REST/NRSF to control neural stem cell proliferation and differentiation.
More...