Property Summary

NCBI Gene PubMed Count 24
PubMed Score 65.95
PubTator Score 41.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Colonic Neoplasms 142 0.0 0.0
Disease Target Count Z-score Confidence
Prostate cancer 175 0.0 3.0
Type 1 diabetes mellitus 109 0.0 3.0
Disease Target Count Z-score Confidence
Beckwith-Wiedemann syndrome 44 4.479 2.2

Expression

  Differential Expression (6)

Disease log2 FC p
ductal carcinoma in situ 1.200 1.9e-02
interstitial cystitis -1.100 3.4e-03
invasive ductal carcinoma 1.200 4.7e-03
lung adenocarcinoma 1.100 5.9e-03
osteosarcoma -1.002 2.8e-03
tuberculosis 1.600 2.8e-05

Gene RIF (15)

AA Sequence

MDGGTLPRSAPPAPPVPVGCAARRRPASPELLRCSRRRRPATAETGGGAAAVARRNERERNRVKLVNLGF      1 - 70
QALRQHVPHGGASKKLSKVETLRSAVEYIRALQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVA     71 - 140
ASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY                     141 - 193
//

Text Mined References (27)

PMID Year Title