Property Summary

Ligand Count 32
NCBI Gene PubMed Count 31
PubMed Score 8.48
PubTator Score 11.18

Knowledge Summary

Patent (985)

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.300 5.4e-03

Gene RIF (21)

AA Sequence

MAPKLLLLLCLFSGLHARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYDKKLRPDIGIKP      1 - 70
TVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNSNMVGLIWIPDTIFRNSKTAE     71 - 140
AHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPMDEHSCPLIFSSYGYPKEEMIYRWRKNSVEA    141 - 210
ADQKSWRLYQFDFMGLRNTTEIVTTSAGDYVVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKD    211 - 280
ATPARTALGITTVLTMTTLSTIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYYSSCRKPTTTK    281 - 350
KTTSLLHPDSSRWIPERISLQAPSNYSLLDMRPPPTAMITLNNSVYWQEFEDTCVYECLDGKDCQSFFCC    351 - 420
YEECKSGSWRKGRIHIDILELDSYSRVFFPTSFLLFNLVYWVGYLYL                           421 - 467
//

Text Mined References (34)

PMID Year Title