Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.96
PubTator Score 4.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (1)

PMID Text
24645645 SSX2, SSX3, and SSX4 are expressed only in 3.5% early-stage non-small cell lung cancer patients.

AA Sequence

MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSF      1 - 70
MRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLC     71 - 140
PPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE                          141 - 188
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24645645 2014 SSX2-4 expression in early-stage non-small cell lung cancer.
20946665 2010 A multigene predictor of metastatic outcome in early stage hormone receptor-negative and triple-negative breast cancer.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12216073 2002 The SSX gene family: characterization of 9 complete genes.
12007189 2002 The cancer-related protein SSX2 interacts with the human homologue of a Ras-like GTPase interactor, RAB3IP, and a novel nuclear protein, SSX2IP.
10749136 2000 Heterogeneous expression of the SSX cancer/testis antigens in human melanoma lesions and cell lines.
9378559 1997 SSX: a multigene family with several members transcribed in normal testis and human cancer.
More...