Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.97
PubTator Score 4.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 6.0e-05
Disease Target Count Z-score Confidence
Synovial sarcoma 25 4.078 2.0

Gene RIF (1)

AA Sequence

MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSF      1 - 70
MRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLC     71 - 140
PPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE                          141 - 188
//

Text Mined References (11)

PMID Year Title