Property Summary

NCBI Gene PubMed Count 33
Grant Count 199
R01 Count 27
Funding $89,245,608.26
PubMed Score 282.03
PubTator Score 90.60

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q99895 A8K082 O00765 Q9NUH5
Symbols CLCR
ELA4

Gene

PANTHER Protein Class (3)

PDB

4H4F  

Gene RIF (29)

PMID Text
27129265 Human anionic trypsinogen is controlled by CTRC in a manner that individual natural mutations are unlikely to increase stability enough to promote intra-pancreatic activation.
26166474 Letter: CTRC intron mutations associated with acute or chronic pancreatitis.
26100556 Mutations in SPINK 1, CFTR and CTRC were detected in 6.3%, 2.3% and 1.8% of patients with acute pancreatitis versus 3.2%, 3.8% and 1.2% of controls. No relationship was found between the detected mutations and severity of pancreatitis.
26022124 Expression of endoplasmic reticulum stress associated CTRC mutants reduces the levels of acetylated tubulin by increasing both the levels and phosphorylation of the deacetylase SIRT2.
26013824 Loss-of-function mutations in CTRC increase the risk for chronic pancreatitis. Describe functional analysis of eight previously uncharacterized natural CTRC variants tested for potential defects in secretion, proteolytic stability, and catalytic activity.
25383785 In Israel, pediatric as well as adult recurrent acute pancreatitis and chronic pancreatitis are often associated with cationic trypsinogen, serine protease inhibitor Kazal type 1, CTRC, or Cystic Fibrosis Transmembrane Conductance Regulator mutations.
25003218 None of the selected 121 pancreatic cancer samples showed a pancreatitis-predisposing mutation in the CTRC gene.
23951356 Rare CTRC genotypes contributed to the development of idiopathic chronic pancreatitis in 4.3% of cases.
23430245 long-range electrostatic attraction toward substrates of concentrated negative charge governs substrate discrimination, which explains CTRC selectivity in regulating active digestive enzyme levels
23135764 In Japanese, 5 novel missense variants in heterozygous form were found in CTRC.
More...

AA Sequence

MLGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLKNDTWRHTCGGTLIASNFVL      1 - 70
TAAHCISNTRTYRVAVGKNNLEVEDEEGSLFVGVDTIHVHKRWNALLLRNDIALIKLAEHVELSDTIQVA     71 - 140
CLPEKDSLLPKDYPCYVTGWGRLWTNGPIADKLQQGLQPVVDHATCSRIDWWGFRVKKTMVCAGGDGVIS    141 - 210
ACNGDSGGPLNCQLENGSWEVFGIVSFGSRRGCNTRKKPVVYTRVSAYIDWINEKMQL                211 - 268
//

Publication (33)

PMID Year Title
27129265 2016 Tighter Control by Chymotrypsin C (CTRC) Explains Lack of Association between Human Anionic Trypsinogen and Hereditary Pancreatitis.
26166474 2015 Report of 2 CTRC Intronic Mutations Associated With Acute or Chronic Pancreatitis and Delineation of Their Pathogenic Molecular Mechanisms.
26100556 2015 Genetic mutations in SPINK1, CFTR, CTRC genes in acute pancreatitis.
26022124 2015 ER stress-associated CTRC mutants decrease stimulated pancreatic zymogen secretion through SIRT2-mediated microtubule dysregulation.
26013824 2015 Mesotrypsin Signature Mutation in a Chymotrypsin C (CTRC) Variant Associated with Chronic Pancreatitis.
25416956 2014 A proteome-scale map of the human interactome network.
25383785 2015 Genetic and electrophysiological characteristics of recurrent acute pancreatitis.
25003218 2014 CFTR, SPINK1, PRSS1, and CTRC mutations are not associated with pancreatic cancer in German patients.
23951356 2013 A conservative assessment of the major genetic causes of idiopathic chronic pancreatitis: data from a comprehensive analysis of PRSS1, SPINK1, CTRC and CFTR genes in 253 young French patients.
23430245 2013 Long-range electrostatic complementarity governs substrate recognition by human chymotrypsin C, a key regulator of digestive enzyme activation.
More...