Property Summary

NCBI Gene PubMed Count 20
PubMed Score 0.33
PubTator Score 1.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession Q99879 Q6NWQ3
Symbols H2B/e
H2BFE
dJ160A22.3

Gene

 GO Function (1)

 GO Process (1)

Protein-protein Interaction (15)

Gene RIF (6)

PMID Text
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22174317 HIV-1 Rev interacting protein, histone cluster 1, H2bm (HIST1H2BM), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
14657027 HIV-1 Rev interacting protein, histone cluster 1, H2bm (HIST1H2BM), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11689053 HIV-1 Rev interacting protein, histone cluster 1, H2bm (HIST1H2BM), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11080476 HIV-1 Rev interacting protein, histone cluster 1, H2bm (HIST1H2BM), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9566873 HIV-1 Rev interacting protein, histone cluster 1, H2bm (HIST1H2BM), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MPEPVKSAPVPKKGSKKAINKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Publication (25)

PMID Year Title
23824326 2013 USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21726816 2011 The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16713563 2006 Histone H2B monoubiquitination functions cooperatively with FACT to regulate elongation by RNA polymerase II.
More...