Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.19
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non-small cell lung carcinoma 317 7.8e-14
lung adenocarcinoma 2716 4.3e-08
psoriasis 6694 1.3e-04

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.200 4.3e-08
non-small cell lung carcinoma 1.200 7.8e-14
psoriasis 2.000 1.3e-04

Gene RIF (4)

AA Sequence

MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKTK                 71 - 128
//

Text Mined References (35)

PMID Year Title