Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1.19
PubTator Score 1.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
non-small cell lung carcinoma 413 7.77041748818231E-14
lung adenocarcinoma 2714 4.27403997633341E-8
psoriasis 6685 1.27497446478415E-4

Synonym

Accession Q99878 A2RUU6 Q5JXQ5
Symbols H2A/E
H2AFE
dJ160A22.4

Gene

  Ortholog (3)

Species Source
Chimp OMA EggNOG
Macaque EggNOG Inparanoid
Anole lizard OMA Inparanoid

 GO Function (1)

 GO Process (1)

Gene RIF (4)

PMID Text
14657027 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11689053 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
11080476 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness
9566873 HIV-1 Tat peptides bind core histones H2A, H2B, H3 and H4, and Tat protein recruits histone acetyltransferases to the HIV-1 LTR promoter leading to acetylation of histones H3 and H4, derepressing chromatin structure and increasing NFkappaB responsiveness

AA Sequence

MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNA      1 - 70
ARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKTESHHKTK                 71 - 128
//

Text Mined References (31)

PMID Year Title
25470042 2014 TRIM37 is a new histone H2A ubiquitin ligase and breast cancer oncoprotein.
24352239 2014 Glutamine methylation in histone H2A is an RNA-polymerase-I-dedicated modification.
24140421 2013 VprBP has intrinsic kinase activity targeting histone H2A and represses gene transcription.
22980979 2012 RNF168 ubiquitinates K13-15 on H2A/H2AX to drive DNA damage signaling.
22713238 2012 A novel ubiquitin mark at the N-terminal tail of histone H2As targeted by RNF168 ubiquitin ligase.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
19203579 2009 RNF168 binds and amplifies ubiquitin conjugates on damaged chromosomes to allow accumulation of repair proteins.
19203578 2009 The RIDDLE syndrome protein mediates a ubiquitin-dependent signaling cascade at sites of DNA damage.
18001825 2007 RNF8 transduces the DNA-damage signal via histone ubiquitylation and checkpoint protein assembly.
18001824 2007 RNF8 ubiquitylates histones at DNA double-strand breaks and promotes assembly of repair proteins.
More...