Property Summary

NCBI Gene PubMed Count 22
Grant Count 4
R01 Count 4
Funding $684,000
PubMed Score 30.22
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Type 1 diabetes mellitus 101 2.0

Expression

 GO Function (1)

 GO Process (1)

Protein-protein Interaction (15)

Gene RIF (6)

PMID Text
24256813 Hypomethylation of ATG4A and HIST1H2BN in ovarian tumor-initiating cells predicts a poor prognosis for ovarian cancer patients.
22174317 HIV-1 Rev interacting protein, histone cluster 1, H2bn (HIST1H2BN), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
14657027 HIV-1 Rev interacting protein, histone cluster 1, H2bn (HIST1H2BN), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11689053 HIV-1 Rev interacting protein, histone cluster 1, H2bn (HIST1H2BN), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
11080476 HIV-1 Rev interacting protein, histone cluster 1, H2bn (HIST1H2BN), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
9566873 HIV-1 Rev interacting protein, histone cluster 1, H2bn (HIST1H2BN), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells

AA Sequence

MPEPSKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDI      1 - 70
FERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK                   71 - 126
//

Publication (26)

PMID Year Title
24256813 2014 Hypomethylation signature of tumor-initiating cells predicts poor prognosis of ovarian cancer patients.
23824326 2013 USP49 deubiquitinates histone H2B and regulates cotranscriptional pre-mRNA splicing.
21925322 2011 Identification of 67 histone marks and histone lysine crotonylation as a new type of histone modification.
21726816 2011 The RING finger protein MSL2 in the MOF complex is an E3 ubiquitin ligase for H2B K34 and is involved in crosstalk with H3 K4 and K79 methylation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16713563 2006 Histone H2B monoubiquitination functions cooperatively with FACT to regulate elongation by RNA polymerase II.
16627869 2006 Quantitative proteomic analysis of post-translational modifications of human histones.
16319397 2006 Characterization of histone H2A and H2B variants and their post-translational modifications by mass spectrometry.
More...