Property Summary

Ligand Count 26
NCBI Gene PubMed Count 163
PubMed Score 229.46
PubTator Score 184.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
medulloblastoma, large-cell 6241 1.2e-06
group 3 medulloblastoma 4104 4.7e-06
ovarian cancer 8520 1.4e-05
lung cancer 4740 1.4e-05
psoriasis 6694 1.8e-04
diabetes mellitus 1728 2.0e-03
dermatomyositis 966 2.4e-03
colon cancer 1478 3.5e-03
Disease Target Count Z-score Confidence
Cancer 2499 3.643 1.8

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer 1.300 3.5e-03
dermatomyositis -1.500 2.4e-03
diabetes mellitus -1.200 2.0e-03
group 3 medulloblastoma 1.500 4.7e-06
lung cancer 2.100 1.4e-05
medulloblastoma, large-cell 1.500 1.2e-06
ovarian cancer 1.500 1.4e-05
psoriasis -1.400 1.8e-04

Protein-protein Interaction (2)

Gene RIF (109)

AA Sequence

MENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSM      1 - 70
FHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVE     71 - 140
LPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY    141 - 210
GFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNI    211 - 280
EFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLC    281 - 350
ELSCSTDYRMR                                                               351 - 361
//

Text Mined References (172)

PMID Year Title