Property Summary

NCBI Gene PubMed Count 138
Grant Count 91
R01 Count 58
Funding $8,315,973.6
PubMed Score 200.50
PubTator Score 184.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis -1.400 0.000
group 3 medulloblastoma 1.500 0.000
medulloblastoma, large-cell 1.500 0.000
colon cancer 1.300 0.003
lung cancer 2.100 0.000
diabetes mellitus -1.200 0.002
ovarian cancer 1.500 0.000
dermatomyositis -1.500 0.002

Synonym

Accession Q99873 B4E3C3 G5E9B6 Q15529 Q2VP93 Q6LEU5 Q8WUW5 Q99872 Q99874 Q9NZ04 Q9NZ05 Q9NZ06
Symbols ANM1
HCP1
IR1B4
HRMT1L2

Gene

PANTHER Protein Class (2)

Protein-protein Interaction (4)

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
652257 screening 4763 / 0 / 365513 Primary biochemical fluorescence polarization-based high throughput screening assay to identify inhibitors of protein arginine methyltransferase 1 (PRMT1)
686951 summary 0 / 0 / 0 Summary of the probe development effort to identify inhibitors of protein arginine methyltransferase 1 (PRMT1)
687036 screening 1396 / 0 / 1921 Fluorescence polarization-based biochemical high throughput confirmation assay to identify inhibitors of protein arginine methyltransferase 1 (PRMT1)

Gene RIF (90)

PMID Text
26795953 findings suggest that PRMT1 is a central regulator of tissue remodeling and that the signaling sequence controlling its expression in primary human lung fibroblast is PDGF-ERK-STAT1.
26766589 Pharmacological inhibition of KDM4C/PRMT1 suppresses transcription and transformation ability of MLL fusions
26575292 The authors demonstrate that RBM15 is methylated by protein arginine methyltransferase 1 (PRMT1) at residue R578, leading to its degradation via ubiquitylation by an E3 ligase (CNOT4).
26571401 PRMT1-mediated methylation of the EGF receptor regulates signaling and cetuximab response.
26527496 there is an imbalance in the vasoconstriction-vasodilation status toward constriction. It is our hypothesis that, in hypoxic stress, a key player in initiating this imbalance is the enzyme, protein arginine methyltransferase-1 (PRMT1).
26460953 Data unveils a novel mechanism of PRMT1-mediated CPC regulation through methylation of INCENP.
26163260 miR-503-mediated PRMT1 could emerge as a potential important biomarker for hepatocellular carcinoma progression and metastasis
26126536 Methylation by PRMT1 may regulate Smurf2 stability and control TGF-beta signaling.
26020839 we define the arginines within the RGG/RG motifs as the site of methylation by PRMT1 both in vitro and in vivo. The arginines within the human hnRNPUL1 RGG/RG motifs were substituted with lysines to generate hnRNPUL1(RK).
25911106 results challenge the unilateral view that increased PRMT1 expression necessarily results in increased ADMA synthesis and demonstrate that enzymatic activity can be regulated in a redox-sensitive manner
More...

AA Sequence

MENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSM      1 - 70
FHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVE     71 - 140
LPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVY    141 - 210
GFDMSCIKDVAIKEPLVDVVDPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNI    211 - 280
EFTRCHKRTGFSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLC    281 - 350
ELSCSTDYRMR                                                               351 - 361
//

Publication (147)

PMID Year Title
26795953 2016 PDGF-BB induces PRMT1 expression through ERK1/2 dependent STAT1 activation and regulates remodeling in primary human lung fibroblasts.
26766589 2016 Targeting Aberrant Epigenetic Networks Mediated by PRMT1 and KDM4C in Acute Myeloid Leukemia.
26575292 2015 Cross-talk between PRMT1-mediated methylation and ubiquitylation on RBM15 controls RNA splicing.
26571401 2015 PRMT1-mediated methylation of the EGF receptor regulates signaling and cetuximab response.
26527496 2015 Effect of protein arginine methyltransferase-1 inhibition on hypoxia-induced vasoconstriction.
26460953 2015 PRMT1 promotes mitosis of cancer cells through arginine methylation of INCENP.
26163260 2015 miR-503 suppresses metastasis of hepatocellular carcinoma cell by targeting PRMT1.
26126536 2015 Protein Arginine Methyltransferase 1 Methylates Smurf2.
26020839 2015 Arginine methylation of hnRNPUL1 regulates interaction with NBS1 and recruitment to sites of DNA damage.
25911106 2015 Redox Control of Protein Arginine Methyltransferase 1 (PRMT1) Activity.
More...