Property Summary

NCBI Gene PubMed Count 18
PubMed Score 2.67
PubTator Score 0.64

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (1)

AA Sequence

MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCS      1 - 70
PSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFM     71 - 140
DQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDW    141 - 210
QWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLIL    211 - 280
AFLQVYDDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWG    281 - 350
GSSSVMSLATKMNELMEK                                                        351 - 368
//

Text Mined References (24)

PMID Year Title