Property Summary

NCBI Gene PubMed Count 17
PubMed Score 1.53
PubTator Score 0.64

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q99871 B4DUH6 D3DWT9 Q96HS8 Q9NP54 Q9UFH9
Symbols UIP1
UCHL5IP

Gene

 GO Function (1)

Gene RIF (1)

PMID Text
11278605 Discusses transcript evidence for TREX1 and TREX2, as well as readthrough transcripts with upstream loci ATRIP and HAUS7.

AA Sequence

MGGARLGARNMAGQDAGCGRGGDDYSEDEGDSSVSRAAVEVFGKLKDLNCPFLEGLYITEPKTIQELLCS      1 - 70
PSEYRLEILEWMCTRVWPSLQDRFSSLKGVPTEVKIQEMTKLGHELMLCAPDDQELLKGCACAQKQLHFM     71 - 140
DQLLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPECDPWPLDMQPLLNKQSDDW    141 - 210
QWASASAKSEEEEKLAELARQLQESAAKLHALRTEYFAQHEQGAAAGAADISTLDQKLRLVTSDFHQLIL    211 - 280
AFLQVYDDELGECCQRPGPDLHPCGPIIQATHQNLTSYSQLLQVVMAVADTSAKAVETVKKQQGEQICWG    281 - 350
GSSSVMSLATKMNELMEK                                                        351 - 368
//

Publication (23)

PMID Year Title
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
19447967 2009 Shifted Transversal Design smart-pooling for high coverage interactome mapping.
19427217 2009 HAUS, the 8-subunit human Augmin complex, regulates centrosome and spindle integrity.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369198 2009 The augmin complex plays a critical role in spindle microtubule generation for mitotic progression and cytokinesis in human cells.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16395595 2006 Human-specific nonsense mutations identified by genome sequence comparisons.
More...