Property Summary

NCBI Gene PubMed Count 9
PubMed Score 24.21
PubTator Score 53.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Dent disease 18 3.862 1.9

Expression

Synonym

Accession Q99865 O75650 Q6IPW2 Q9UJJ0
Symbols DXF34
SPIN2
TDRD25
dJ323P24.1

Gene

  Ortholog (1)

Species Source Disease
Dog OMA Inparanoid

Gene RIF (2)

AA Sequence

MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKG      1 - 70
TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE     71 - 140
HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI    141 - 210
GKHVEYTKEDGSKRIGMVIHQVETKPSVYFIKFDDDFHIYVYDLVKKS                          211 - 258
//

Text Mined References (9)

PMID Year Title