Property Summary

NCBI Gene PubMed Count 8
PubMed Score 23.21
PubTator Score 53.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

Synonym

Accession Q99865 O75650 Q6IPW2 Q9UJJ0
Symbols DXF34
SPIN2
TDRD25
dJ323P24.1

Gene

 GO Component (1)

 Compartment GO Term (1)

Gene RIF (2)

PMID Text
22944692 Positional proteomics analysis identifies the cleavage of human spindlin family, member 2A (SPIN2A) at amino acid residues 11-12 by the HIV-1 protease
12145692 SPIN-2. SPIN-2 is a novel nuclear protein from HL-60 cells that functions to regulate cell cycle progression and this activity is related to the inhibition of apoptosis following the removal of essential growth factors

AA Sequence

MKTPNAQEAEGQQTRAAAGRATGSANMTKKKVSQKKQRGRPSSQPRRNIVGCRISHGWKEGDEPITQWKG      1 - 70
TVLDQVPINPSLYLVKYDGIDCVYGLELHRDERVLSLKILSDRVASSHISDANLANTIIGKAVEHMFEGE     71 - 140
HGSKDEWRGMVLAQAPIMKAWFYITYEKDPVLYMYQLLDDYKEGDLRIMPESSESPPTEREPGGVVDGLI    141 - 210
GKHVEYTKEDGSKRIGMVIHQVETKPSVYFIKFDDDFHIYVYDLVKKS                          211 - 258
//

Text Mined References (8)

PMID Year Title
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12145692 2002 Functional cloning of SPIN-2, a nuclear anti-apoptotic protein with roles in cell cycle progression.
12107411 2002 Expressed sequence tag analysis of human retina for the NEIBank Project: retbindin, an abundant, novel retinal cDNA and alternative splicing of other retina-preferred gene transcripts.
9271673 1997 The structure of DXF34, a human X-linked sequence family with homology to a transcribed mouse Y-linked repeat.